Overheid.nl| Zoekpagina

De wegwijzer naar informatie en diensten van alle overheden

Naar zoeken

Verordening PDV certificatie GMP diervoedersector 2003[Regeling vervallen per 01-01-2006.]

Geldend van 05-06-2005 t/m 31-12-2005

Verordening van het Productschap Diervoeder van 11 april 2003 inzake een nieuwe erkenningsregeling GMP diervoedersector

Het bestuur van het Productschap Diervoeder:

Het bestuur van het Productschap Diervoeder:

Gelet op de artikelen 93 en 95 van de Wet op de bedrijfsorganisatie en de artikelen 2, 4 en 9 van de Instellingsverordening Akkerbouwproductschappen 1997;

Gelet op de noodzaak dat de diervoederketen de veiligheid van producten als voeding voor het dier en daarmee het dier en producten van het dier als voeding voor de mens zeker stelt

Gelet op de noodzaak om in dit kader een geloofwaardig en effectief kwaliteitscertificeringsysteem op te zetten voor de bedrijven in de diervoederketen, waarvan de normen en beheersmaatregelen mede adequate beoordeling en sanctionering kunnen worden gehandhaafd,

Besluit:

1. Begripsbepalingen [Vervallen per 01-01-2006]

Artikel 1 [Vervallen per 01-01-2006]

Deze verordening neemt over de terminologie van de Richtlijnen 701524lEEG. 79/373EEG, 82/471/EEG, 90/167/EG, 92/117/EEG, 93/113/EG, 95/69/EG, 96/251/EEG, 2002/32/EG, enig nadere wettelijke regeling van de Europese Gemeenschap van toepassing voor de diervoedersector, en de Verordening PDV bevoegdheden en werkwijze organen en inrichting secretariaat 1999 en verstaat voorts onder:

a.

GMP-standaard

:

Good Manufacturing/Managing Practice standaard, zijnde de voorwaarden en criteria met betrekking tot bedrijfsinrichting, bedrijfsvoering, procescondities, processen, procedures, verantwoordelijkheden en voorzieningen zoals aangegeven in de bijlagen GMP01 tot en met GMP12 bij deze verordening, waaraan moet worden voldaan om te waarborgen dat de kwaliteit wordt gerealiseerd;

b.

QC-standaard

:

Standard Quality Control of Feed Materials for Animal Feed, zijnde de voorwaarden en criteria met betrekking tot bedrijfsinrichting, bedrijfsvoering, procescondities, processen, procedures, verantwoordelijkheden en voorzieningen zoals aangegeven in de bijlage GMP13 bij deze verordening, waaraan de goedgekeurde leverancier dient te voldoen;

c.

onderneming

:

de aan het economisch verkeer deelnemende technisch-organisatorische eenheid die activiteiten verricht met betrekking tot op- en overslag, be- en verwerking, productie, handel dan wel vervoer van voedermiddelen, voormengsels, toevoegingsmiddelen of diervoeders (incl. mengvoeders);

d.

bedrijfseenheid

:

iedere naar locatie of functie te onderscheiden eenheid binnen een onderneming als bedoeld onder b. waarbinnen activiteiten worden verricht waarvoor een GMP-standaard bestaat, met dien verstande dat alle locaties van een onderneming welke uitsluitend handel drijft als een bedrijfseenheid worden aangemerkt;

e.

ondernemer

:

de natuurlijke- of rechtspersoon ongeacht nationaliteit, woon- of vestigingsplaats die een onderneming drijft als bedoeld onder c.;

f.

deelnemer

:

de ondernemer aan wie overeenkomstig het bepaalde bij deze verordening een erkenningscertificaat is verleend;

g.

kritische punten

:

die punten in het totale proces van voortbrenging en behandeling, die een rechtstreekse nadelige invloed hebben op de basiskwaliteit van voedermiddelen, voormengsels, toevoegingsmiddelen of diervoeders;

h.

certificatie-instelling

:

de gespecialiseerde instelling die ingevolge paragraaf 5 van deze verordening door het productschap als zodanig is geaccepteerd;

i.

basiskwaliteit

:

de kenmerken van toevoegingen diergeneesmiddelen, voormengsels, voedermiddelen en diervoeders, die:

  • a. ten behoeve van de veiligheid van het dier, de consument van voedermiddelen van dierlijke oorsprong en/of het milieu in wetgeving (in Europese Unie en aanvullend nationaal) zijn vastgelegd,

  • b. in aanvulling op a) zijn geformuleerd op basis van consensus in de diervoedersector na overleg met de organisaties van de betreffende veehouderijsectoren en daar achterliggende (verwerkende) sectoren;

j.

norm

:

iedere norm met betrekking tot basiskwaliteit als bedoeld onder i, zoals genoemd, dan wel vastgesteld in bijlage GMP14 bij deze verordening;

k.

actiegrens

:

waarde bij overschrijding waarvan onderzoek dient te worden gedaan naar de oorzaak en corrigerende maatregelen dienen te worden genomen om de oorzaak weg te nemen of te beperken;

1.

afkeurgrens

:

waarde bij overschrijding waarvan het product ongeschikt wordt geacht om te worden gebruikt als voedermiddel of diervoeder;

m.

GMP-regeling

:

het geheel van voorwaarden en criteria omtrent het kwaliteitssysteem zoals vastgelegd in de GMP- standaarden, alsmede van de normen met betrekking tot basiskwaliteit en de daarbij behorende nader vastgestelde beheersingsmaatregelen, bij of krachtens deze verordening van toepassing zijnde;

n.

College

:

het college als bedoeld in het Besluit PW College van Deskundigen Diervoedersector 2000;

o.

goedgekeurde leverancier

:

de buitenlandse leverancier van voedermiddelen waarvan een certificatie-instelling heeft vastgesteld dat het toegepaste kwaliteitssysteem voldoet aan de Standard Quality Control of Feed Materials als opgenomen in de bijlage GMP13.

p.

collectieve beeldmerken

:

het collectieve beeldmerk "GMP-gecertificeerd bedrijf", het collectieve beeldmerk "GMP+HACCP-gecertificeerd bedrijf", het collectieve beeldmerk "HACCP", het collectieve beeldmerk "GMP-gecertificeerd transportbedrijf', en het collectieve beeldmerk "QC-bedrijf", als opgenomen in de bijlage GMP15;

Artikel 2 [Vervallen per 01-01-2006]

Onverminderd de normen als bedoeld in artikel 1, onderdeel j., worden toevoegings- en diergeneesmiddelen, voormengsels, voedermiddelen en diervoeders waarin stoffen aanwezig zijn die kennelijk dienen om de aanwezigheid van andere stoffen te maskeren in het kader van de GMP-regeling als ondeugdelijk aangemerkt.

2. Erkenningsprocedure [Vervallen per 01-01-2006]

Artikel 3 [Vervallen per 01-01-2006]

De ondernemer die de basiskwaliteit jegens zijn afnemers wil borgen overeenkomstig de GMP-regeling kan een erkenningscertificaat aanvragen.

Artikel 4 [Vervallen per 01-01-2006]

  • 1 Een erkenningscertificaat wordt aangevraagd bij een door het productschap ingevolge artikel 10 geaccepteerde certificatie-instelling.

  • 2 Een erkenningscertificaat wordt afgegeven indien:

    • -

      ten genoegen van de certificatie-instelling wordt aangetoond dat in elke bedrijfseenheid alle activiteiten waarvoor een GMP-standaard of de QC-standaard van toepassing is daaraan voldoen en

    • -

      over alle wettelijk voorgeschreven registraties, erkenningen en vergunningen wordt beschikt

      en

    • -

      opgave wordt gedaan van de zeggenschapsverhoudingen binnen de onderneming, alsmede het samenstel van ondernemingen waarvan de onderneming deel uitmaakt.

  • 3 Indien op één locatie meerdere ondernemers activiteiten uitoefenen waarvoor een GMP-standaard bestaat, dient ieder van hen voor deze activiteiten over een erkenningscertificaat te beschikken.

  • 4 Indien de acceptatie van de certificatie-instelling van wie de deelnemer een erkenningscertificaat heeft, wordt ingetrokken, is de deelnemer verplicht binnen drie maanden een overeenkomst met een andere geaccepteerde certificatie-instelling te sluiten. Deze CI dient vervolgens binnen 3 maanden na het sluiten van de overeenkomst een nieuw erkenningscertificaat af te geven.

Artikel 5 [Vervallen per 01-01-2006]

  • 1 Indien ten genoegen van de certificatie-instelling is aangetoond dat aan de voorwaarden van de toepasselijke GMP-standaard dan wel de QC-standaard wordt voldaan, verleent de certificatie-instelling aan de ondernemer per bedrijfseenheid een erkenningscertificaat waarin de GMP-standaarden worden genoemd, die ZW beoordeeld en waaraan wordt voldaan.

  • 2 Het erkenningscertificaat heeft een geldigheidsduur van drie jaar. De geldigheidsduur wordt telkenmale met drie jaar verlengd tenzij:

    • a. de deelnemer uiterlijk drie maanden voor het verstrijken van de geldigheidsduur schriftelijk te kennen heeft gegeven van verlenging af te zien, of

    • b. de beoordeling als bedoeld in het derde lid tot een negatieve uitkomst leidt, of

    • c. toepassing wordt gegeven aan het bepaalde in artikel 13, eerste lid.

  • 3 Alvorens de certificatie-instelling tot verlenging van het erkenningscertificaat overgaat, voert hij een herbeoordeling uit ten aanzien van het voldoen aan de GMP-regeling.

Artikel 5a [Vervallen per 01-01-2006]

  • 1 Een deelnemer die diervoeders produceert kan voor een niet-gecertificeerde tussenhandelaar garant staan, indien hij via deze tussenhandelaar aflevert aan een veehouder en wil waarborgen dat alle diervoeder van deze tussenhandelaar overeenkomstig de GMP-standaard GMP02 of overeenkomstig GMP04 voor zover van toepassing is geproduceerd.

  • 2 De in het eerste lid bedoelde tussenhandelaar mag geen etiket of begeleidend document wijzigen, geen tussenopslag in bulk en geen bulktransport verrichten en slechts overwegend van één producent diervoeders afnemen.

  • 3 De deelnemer houdt een lijst bij van tussenhandelaren en producten waarvoor hij garant staat en deelt iedere wijziging binnen één maand mee aan de certificatie-instelling.

3. Registratie [Vervallen per 01-01-2006]

Artikel 6 [Vervallen per 01-01-2006]

  • 1 De certificatie-instelling doet aan de secretaris onverwijld opgave van de naam, het adres en de vestigingsplaats, voor zover nodig met vermelding van bedrijfseenheden, van elke ondernemer waaraan hij een erkenningscertificaat verleent, alsmede voor welke GMP-standaard(en) en aanvullende aanduidingen als bedoeld in artikel 7, vierde lid, dan wel de QC-standaard het erkenningscertificaat is verleend.

  • 2 De certificatie-instelling stelt de secretaris binnen één maand schriftelijk in kennis van iedere wijziging van de gegevens als bedoeld in het eerste lid.

  • 3 De certificatie-instelling stelt de secretaris binnen 24 uur schriftelijk in kennis van de namen, adressen en vestigingsplaatsen van de ondernemers waarvan het erkenningscertificaat is geschorst, ingetrokken of niet is verlengd. De secretaris is gerechtigd om belanghebbenden hierover actief te informeren.

  • 4 De certificatie-instelling doet aan de secretaris onverwijld opgave van de tussenhandelaren en de producten waarvoor overeenkomstig artikel 5a deelnemers garant staan.

  • 5 De secretaris legt de in de voorgaande leden bedoelde gegevens vast in een openbaar register.

4. Gebruik van aanduidingen en collectieve beeldmerken [Vervallen per 01-01-2006]

Artikel 7 [Vervallen per 01-01-2006]

  • 1 De deelnemer is gerechtigd tot het gebruik van het collectieve beeldmerk "GMP-gecertificeerd bedrijf':

    • a. op of bij de bedrijfseenheid waarvoor de erkenning is verleend;

    • b. op of bij de producten afkomstig van de onder a. bedoelde bedrijfseenheid, mits de handel in, op- en overslag, be- en verwerking dan wel productie van de producten heeft plaatsgevonden overeenkomstig de daarop van toepassing zijnde GMP-standaarden;

    • c. op bescheiden afgegeven door de onder a. bedoelde bedrijfseenheid.

  • 2 Onverminderd het bepaalde in het eerste lid is de deelnemer die blijkens zijn erkenningscertificaat voldoet aan het bepaalde in bijlage GMP01, paragraaf 1, gerechtigd tot het gebruik van het collectieve beeldmerk "GMP+HACCP-gecertificeerd bedrijf' en het collectieve beeldmerk "HACCP op de wijze als genoemd in het eerste lid.

  • 3 Onverminderd het bepaalde in het eerste en het tweede lid is de deelnemer die blijkens zijn erkenningscertificaat ten aanzien van transport voldoet aan het bepaalde in bijlage GMP07 gerechtigd tot het gebruik van het collectieve beeldmerk "GMP-gecertificeerd transportbedrijf' op de wijze als genoemd in het eerste lid.

  • 4 De deelnemer is gerechtigd een of meer aanvullende aanduidingen te vermelden, indien hij voldoet aan de desbetreffende aanvullende criteria voor productkenmerken vermeld in bijlage GMP14.

  • 5 De goedgekeurde leverancier is gerechtigd tot het gebruik van het collectieve beeldmerk "QC-bedrijf' opgenomen in bijlage GMP15 op de wijze als genoemd in het eerste lid.

Artikel 8 [Vervallen per 01-01-2006]

Iedere deelnemer is gerechtigd de collectieve beeldmerken in een vertaalde versie in het Duits, Engels, Frans, Grieks, Italiaans of Spaans te gebruiken. De vertaalde beeldmerken moeten overeenkomen met de beeldmerken, afgebeeld in bijlage GMP15 bij deze verordening.

Artikel 9 [Vervallen per 01-01-2006]

  • 1 Iedere gebruiker van één van de collectieve beeldmerken is verplicht iedere inbreuk die hem ter kennis komt mede te delen aan zijn certificatie-instelling, of het productschap.

  • 2 Onverminderd de bevoegdheid van het productschap is iedere certificatie-instelling zelfstandig bevoegd tot het instellen van een vordering tegen een ieder die, zonder daartoe gerechtigd te zijn, gebruik maakt van een collectief beeldmerk of van een daarmee overeenstemmend teken.

  • 3 Iedere gebruiker van één van de collectieve beeldmerken is bevoegd om zich te voegen of tussen te komen in een geding als bedoeld in het tweede lid.

5. Acceptatie van certificatie-instellingen [Vervallen per 01-01-2006]

Artikel 10 [Vervallen per 01-01-2006]

  • 1 Het verzoek tot acceptatie als certificatie-instelling wordt ingediend bij het productschap.

  • 2 Het bestuur stelt, gehoord het College, bij besluit de procedure en voorwaarden voor acceptatie van een certificatie-instelling vast.

  • 3 Na indiening van de aanvraag tot acceptatie beoordeelt het productschap binnen een termijn van drie maanden of de certificatie-instelling voldoet aan de voorwaarden bedoeld in het tweede lid.

  • 4 De acceptatie van een certificatie-instelling wordt namens het bestuur verleend door de secretaris bij wederzijdse overeenkomst met een duur van vier jaren.

  • 5 Bij acceptatie verkrijgt de certificatie-instelling het niet exclusieve recht, onder de bij de in het vierde lid genoemde overeenkomst nader te stellen voorwaarden, met inachtneming van het bepaalde in paragraaf 2 aan ondernemers in de diervoedersector erkenningscertificaten te verlenen.

  • 6 De namen, adressen en vestigingsplaatsen van de geaccepteerde certificatie instellingen worden door de secretaris vastgelegd in een openbaar register.

  • 7 Bij wijziging van de naam, het adres of de vestigingsplaats dan wel bij opheffing is de certificatie-instelling verplicht het productschap binnen één maand vooraf daarvan in kennis te stellen.

  • 8 De certificatie-instelling die een verzoek tot acceptatie indient als bedoeld in het eerste lid, is aan het productschap een door het bestuur vast te stellen vergoeding verschuldigd. De geaccepteerde certificatie-instellingen zijn jaarlijks een door het bestuur vast te stellen licentievergoeding aan het productschap verschuldigd, dat bestaat uit een vast bedrag per certificatie-instelling en een bedrag per door deze erkende deelnemer.

Artikel 11 [Vervallen per 01-01-2006]

  • 1 Een certificatie-instelling neemt bij de beoordeling van ondernemers, alsmede bij de verlening, verlenging, opschorting en intrekking van een erkenningscertificaat strikt in acht het bepaalde in deze verordening, alsmede de door het bestuur, gehoord het College, bij besluit vastgestelde richtlijnen voor beoordeling en certificatie.

  • 2 Het Bureau Coördinatie Diervoedercertificatie en -controle houdt toezicht op de naleving door de certificatie-instellingen van de verplichtingen bedoeld in het voorgaande lid.

  • 3 Het productschap neemt bij de beoordeling van certificatie-instellingen strikt in acht het bepaalde in deze verordening, alsmede de door het bestuur, gehoord het College, bij besluit vastgestelde richtlijnen voor beoordeling en sanctionering van certificatie-instellingen.

  • 4 Indien de certificatie-instelling de verplichtingen in of krachtens deze verordening niet naleeft, kan de secretaris namens het bestuur:

    • -

      geen verlenging van de erkenning, als bedoeld in artikel 10, vierde lid, verlenen, of

    • -

      de erkenning schorsen of

    • -

      de erkenning intrekken

    en dit besluit bekend maken.

6. Verplichtingen deelnemers [Vervallen per 01-01-2006]

Artikel 12 [Vervallen per 01-01-2006]

  • 1 De deelnemer is verplicht alle medewerking te verlenen aan de controle bedoeld in artikel 11 en aan het toezicht door of vanwege het productschap op de naleving van de voorwaarden en voorschriften bij of krachtens deze verordening gesteld.

  • 2 De deelnemer is verplicht het bepaalde bij of krachtens deze verordening na te leven.

  • 3 De deelnemer dient bij wijziging van de GMP-regeling binnen één jaar na bekendmaking daarvan aan de wijziging te voldoen, tenzij het bestuur, gehoord het College, een kortere termijn bepaalt.

Artikel 13 [Vervallen per 01-01-2006]

  • 1 Indien de deelnemer de verplichtingen uit artikel 12 niet naleeft, dan wel bij de herbeoordeling als bedoeld in artikel 4, derde lid, niet aan de voorwaarden en criteria van de GMP-regeling blijkt te voldoen, kan de certificatieinstelling:

    • -

      geen verlenging van het certificaat, betrekking hebbend op alle voor de onderneming van toepassing zijnde GMP-standaarden en QC-standaard als bedoeld in artikel 4, tweede lid, verlenen, of

    • -

      het certificaat, betrekking hebbend op alle voor de onderneming van toepassing zijnde GMP-standaarden en QC-standaard, schorsen voor de duur van maximaal drie maanden, en

    • -

      het certificaat, betrekking hebbend op alle voor de onderneming van toepassing zijnde GMP-standaarden en QC-standaard, intrekken indien na afloop van de in het voorgaande gedachtestreepje genoemde schorsing de tekortkomingen niet ten genoegen van de certificatie-instelling aantoonbaar zijn opgeheven.

  • 2 Na het intrekken dan wel het niet verlengen van een erkenning is de ondernemer gedurende een periode van een jaar uitgesloten van de mogelijkheid tot het aanvragen van een erkenning.

  • 3 Indien daartoe naar het oordeel van het productschap gehoord het College aanleiding bestaat, kan de in het voorgaande lid bedoelde uitsluiting tevens iedere andere ondernemer betreffen waarin al dan niet middellijk en op welke wijze ook beslissende zeggenschap wordt uitgeoefend of verkregen door:

    • -

      de uitgesloten ondernemer, of

    • -

      een rechtspersoon die in de uitgesloten ondernemer al dan niet middellijk en op welke wijze ook beslissende zeggenschap uitoefent of in de erkenningsperiode heeft uitgeoefend, of

    • -

      een natuurlijke persoon die in de uitgesloten ondernemer al dan niet middellijk en op welke wijze ook beslissende zeggenschap uitoefent of in de erkenningsperiode heeft uitgeoefend.

    Het bepaalde in artikel 6, derde en vierde lid, is van overeenkomstige toepassing.

  • 4 Op grond van redelijkheid en billijkheid kan de certificatie-instelling besluiten de niet-verlenging, schorsing of intrekking van het certificaat, als bedoeld in het eerste lid, op één of meer GMP-standaarden betrekking te laten hebben.

7. Geschillenbeslechting [Vervallen per 01-01-2006]

Artikel 14 [Vervallen per 01-01-2006]

In aanvulling op de eigen geschillenregeling van de certificatie-instelling is op geschillen tussen deelnemers en certificatie-instellingen inzake het gebruik door de certificatieinstelling van zijn bevoegdheden ingevolge artikel 5, eerste lid en artikel 13, eerste lid, van toepassing het als bijlage GMP16 bij deze verordening opgenomen geschillenreglement.

8. Overgangs- en slotbepalingen [Vervallen per 01-01-2006]

Artikel 15 [Vervallen per 01-01-2006]

  • 2 De voorzitter is bevoegd, namens het bestuur, bij besluit de bijlage "Productnormen GMP-regeling diervoedersector, GMP 14" te wijzigen, indien het gaat om normen of verboden producten die reeds nationaal of communautair bij een wettelijke regeling geregeld zijn.

Artikel 16 [Vervallen per 01-01-2006]

De volgende verordeningen en besluiten worden ingetrokken:

  • -

    Verordening PDV erkenningsregeling GMP diervoedersector 2000;

  • -

    Verordening Vvr regeling diervoeders voor de productie van varkensvlees volgens Japanstandaard 1994;

  • -

    Besluit WR erkenningsregeling laboratoria bedrijfsinterne controle diervoedersector 1996;

  • -

    Besluit PDV normen GMP diervoedersector 1999;

  • -

    Besluit Vvr regeling leveranciers voeders voor scharreldieren 1995;

  • -

    Besluit Vvr regeling leveranciers voeders voor grasmerk 1995;

  • -

    Besluit PDV transport diervoeders GMP 2000;

  • -

    Besluit PDV gebruik en toezicht collectieve beeldmerken GMP diervoedersector 2001;

  • -

    Besluit Vvr nadere voorschriften GMP-erkenning;

  • -

    Besluit PDV beoordelings- en toezichtsprocedure GMP diervoedersector 1998;

  • -

    Besluit PDV gebruik Quality Control beeldmerk 2002.

Artikel 17 [Vervallen per 01-01-2006]

De op de dag van inwerkingtreding van deze verordening bestaande erkenningen op grond van de Verordening PDV erkenningsregeling GMP diervoedersector 2000 blijven van kracht en erkenningen die vanaf 1 december 2002 tot de dag van inwerkingtreding zijn verlopen worden geacht te zijn verlengd met één jaar, onder voorwaarde dat de deelnemer vóór 1 augustus 2003 een overeenkomst met een geaccepteerde certificatie-instelling sluit voor uitvoering van een beoordeling als bedoeld in artikel 11, eerste lid.

Artikel 18 [Vervallen per 01-01-2006]

Deze verordening wordt gepubliceerd in het Verordeningenblad Bedrijfsorganisatie en treedt in werking met ingang van 1 juli 2003. Bij publicatie op of na 30 juni 2003 treedt deze verordening in werking op de tweede dag na publicatie en werkt terug tot en met 1 juli 2003.

Artikel 19 [Vervallen per 01-01-2006]

Deze verordening wordt aangehaald als: Verordening PDV certificatie GMP diervoedersector 2003.

Den Haag, 11 april 2003

J.H.M. Kienhuis

voorzitter

J. den Hartog

secretaris

01. Algemene GMP-standaard diervoedersector GMP01 ; 11-04-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied

3

2 Normatieve Verwijzingen

3

3 Termen, Definities, Doelgroepen

4

 

3.1

Termen en Definities

4

 

3.2

Doelgroepen

5

4 Kwaliteitssysteemeisen

5

 

4.1

Directieverantwoordelijkheid

5

  4.1.1 Kwaliteitsbeleid

5

  4.1.2 Organisatie

6

 

4.1.2.1

Verantwoordelijkheid en bevoegdheid

6

 

4.1.2.2

Middelen

6

 

4.1.2.3

Directievertegenwoordiger

6

 

4.1.2.4

HACCP-team

6

  4.1.3 Beoordeling door de directie 6
 

4.2

Kwaliteitssysteem

6

  4.2.1 Algemeen

6

  4.2.2 Kwaliteitssysteemprocedures

7

  4.2.3 Kwaliteitsbeheersingsplan

7

  4.2.4 Eindproductspecificaties

7

 

4.3

Normdocumenten

8

  4.3.1 Algemeen 8
  4.3.2 Aanvaarden van een opdracht (beoordeling) 8
  4.3.3 Registraties 8
 

4.4

Ontwerpbeheersing

8

 

4.5

Document- en Gegevensbeheer

8

  4.5.1 Algemeen 8
  4.5.2 Goedkeuring en uitgifte van documenten en gegevens 8
  4.5.3 Wijzigingen van documenten en gegevens 8
 

4.6

Inkoop

9

  4.6.1 Algemeen 9
  4.6.2 Het evalueren van toeleveranciers 9
  4.6.3 Inkoopgegevens 9
  4.6.4 Verificatie van ingekochte producten 9
 

4.7

Beheersing van door de Afnemer verstrekte Producten

9

 

4.8

Identificatie en Naspeurbaarheid

9

 

4.9

Procesbeheersing

10

  4.9.1 Algemeen 10
 

4.9.1.1

Processchema's

10

 

4.9.1.2

Bedrijfsinrichting

10

 

4.9.1.3

Vogels, huisdieren en ongedierte

10

  4.9.2 Gevaren, risico's en beheersmaatregelen 10
 

4.9.2.1

Gevaren-identificatie

10

 

4.9.2.2

Risicobeoordeling

10

 

4.9.2.3

Beheersmaatregelen

11

 

4.9.2.4

Beoordeling kritieke beheersingspunten

11

  4.9.3 Bedrijfshygiëne en documentatie 11
 

4.10

Keuring en Beproeving

11

  4.10.1 Algemeen 11
  4.10.2 Ingangskeuring en -beproeving 12
  4.10.3 Tussentijdse keuring en beproeving 12
4.10.4 Hygiëne inspecties 12
4.10.5 Eindkeuring en -beproeving 12
4.10.6 Registraties van keuringen en beproevingen 12

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

12

4.11.1 Algemeen 12
4.11.2 Beheersingsprocedure 12

4.12

Keurings- en Beproevingsstatus

13

4.13

Beheersing van Producten met Afwijkingen

13

4.13.1 Algemeen 13
4.13.2 Beoordeling en afhandeling van producten met afwijkingen 13
4.13.3 Terughalen geleverde producten 13

4.14

Corrigerende en Preventieve Maatregelen

13

4.14.1 Algemeen 13
4.14.2 Corrigerende maatregelen 13
4.14.3 Preventieve maatregelen 14
4.14.4 Early warning procedure 14

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

14

4.15.1 Algemeen 14
4.15.2 Behandeling 14
4.15.3 Opslag 14
4.15.4 Verpakking 14
4.15.5 Conservering 14
4.15.6 Aflevering 14

4.16

Beheersing van Kwaliteitsregistraties

15

4.17

Interne Kwaliteitsaudits

15

4.18

Opleiding

15

4.19

Nazorg

16

4.20

Statistische Technieken

16

4.20.1 Identificatie van behoefte 16
4.20.2 Procedures 16

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

De GMP-regeling diervoedersector is opgezet voor de handel in, productie van, op- en overslag van en transport van mengvoeders, voedermiddelen, voormengsels en toevoegingsmiddelen.

Het doel van de GMP-regeling is producten en diensten voort te brengen, op een wijze die in hoge mate waarborgt dat leveranciers van deze producten en diensten voldoen aan de eisen in wet- en regelgeving, verband houdende met de veiligheid voor mens, dier en milieu (basiskwaliteit) en aan de additionele eisen die overeengekomen zijn met de ketenpartijen in de dierlijke productieketen in het kader van IKB-regelingen van de vee-, vlees-, eieren- en KKM-regeling in de zuivelsector of aanvullende kwaliteitsregelingen.

Het zelf door de ondernemer, via een kwaliteitsborgingsysteem, aantoonbaar maken dat basiskwaliteit wordt gewaarborgd is de basis voor de integrale ketenbeheersing (IKB) in de veehouderijsectoren. Diervoeders, geleverd door GMP- gecertificeerde ondernemers, zijn een voorwaarde in IKB programma's voor de verschillende diersectoren.

De aandachtsvelden van basiskwaliteit in het kader van de GMP-regeling diervoedersector zijn het beheersen van:

  • omgang met toevoegingmiddelen en diergeneesmiddelen;

  • gehalten van ongewenste stoffen en producten;

  • hygiënisch werken (beheersing bacteriologische gesteldheid).

Deze GMP-standaard is geformuleerd volgens de systematiek van de EN-ISO-9001:1994. De teksten van de ISO-9001 zijn aangepast door aanvullingen en beperkingen in de tekst te verwerken.

Specifieke voorschriften (op kritische punten) voor onderscheidenlijke activiteiten zijn opgenomen in aanvullende GMP-standaarden die complementair aan deze algemene code zijn. Producenten van en handelaren in mengvoeders, voormengsels en voedermiddelen en toevoegingsmiddelen dienen voor de op- en overslag- en transportactiviteiten die zij zélf uitoefenen bovendien te voldoen aan de bepalingen in de aanvullende GMP- standaarden voor op- en overslag respectievelijk transport.

De ondernemer dient aantoonbaar te maken dat alle verrichtingen die worden uitgevoerd en waarvoor een aanvullende GMP-standaard bestaat, aan de GMP-regeling voldoen. Indien een onderneming meerdere bedrijfseenheden heeft, dienen deze alle over een GMP-certificatie te beschikken, tenzij vanuit deze bedrijfseenheid geen producten of diensten aan veehouders in Nederland worden aangeboden dan wel afgeleverd.

Ook ingeval een ondernemer vanuit verschillende rechtspersonen op een zelfde locatie producten of diensten aanbiedt, dienen de verrichtingen van alle betreffende rechtspersonen onder de GMP-regeling gebracht te worden.

Deze GMP-standaard sluit aan bij de HACCP (Hazard Analyses of Critical Control Points) benadering. Bij HACCP worden alle schakels in het voortbrengingsproces geanalyseerd en worden de potentiële gevaren (hazards) voor productkwaliteit en -veiligheid geïdentificeerd en beschreven. Alle mogelijke risico's voor productkwaliteit en -veiligheid moeten adequaat via opgestelde procedures en instructies worden beheerst.

Alle elementen met betrekking tot de voortbrenging van diervoeder(middelen) die de veiligheid van mens, dier en milieu beïnvloeden, zijn geïnventariseerd en worden beheerst volgens de voorwaarden in deze code, middels kritieke beheersingspunten (CCP's) en punten van aandacht (PVA's).

Conform de HACCP-handleiding diervoedersector van het Productschap Diervoeder zijn alle schakels van het voortbrengingsproces geanalyseerd en zijn de potentiële gevaren (hazards) voor productkwaliteit en -veiligheid geïdentificeerd en beschreven. Alle mogelijke risico's voor productkwaliteit en -veiligheid moeten adequaat via opgestelde procedures en instructies worden beheerst. Deze verplichting geldt voor alle activiteiten waarop de GMP-regeling betrekking heeft, met uitzondering van transport.

2. Normatieve verwijzigingen [Vervallen per 01-01-2006]

Deze GMP-standaard is een onderdeel van de Verordening PDV erkenningsregeling GMP diervoedersector 2003, waarin de GMP-regeling diervoedersector is opgenomen. Het doel is te voldoen aan de eisen omtrent basiskwaliteit. Dit behelst de normen en voorschriften zoals vastgelegd in de diervoederwetgeving, aangevuld sectoraal afgesproken normen, vastgelegd in de GMP-regeling.

De normen en voorschriften die in het kader van deze GMP-standaard geborgd dienen te worden, zijn door het bestuur van het productschap bij of krachtens de GMP-regeling vastgesteld. Ondernemers buiten Nederland dienen aantoonbaar te voldoen aan de in dat land vigerende wetgeving en de aanvullende eisen in het kader van de GMP-regeling.

Voor het uitvoeren van de HACCP-risicobeoordeling dient het bedrijf de HACCP-Handleiding Diervoedersector (GMP20) als richtlijn te hanteren.

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

3.1. Termen en definities [Vervallen per 01-01-2006]

Voor de definitie van onderstaande termen wordt verwezen naar de Verordening PDV erkenningsregeling GMP diervoedersector 2003 en de EG-richtlijnen met betrekking tot diervoeders.

Er wordt tevens aangesloten bij de termen en definities van ISO 8402:1994.

Aanvullend zijn de volgende termen van toepassing:

  • Afnemer

    Diegene die producten/diensten koopt van de ondernemer.

  • Basiskwaliteit

    De kenmerken van toevoeging- en diergeneesmiddelen, voormengsels, voedermiddelen en diervoeders die:

    ten behoeve van de veiligheid van het dier, de consument van voedingsmiddelen van dierlijke oorsprong en/of het milieu in wetgeving (in de Europese Unie en aanvullend nationaal) zijn vastgelegd,

    in aanvulling op a) zijn geformuleerd op basis van consensus in de diervoedersector na overleg met de organisaties van de betreffende veehouderijsectoren en daar achterliggende (verwerkende) sectoren.

  • Behandeling

    Het behandelen van voedermiddelen en/of diervoeder (mede) met het oog op reductie van micro-organismen.

  • Thermische behandeling

    Het om procestechnische en/of hygiënische reden toedienen van energie waarbij de (inwendige) producttemperatuur van voedermiddelen en/of diervoeder stijgt, (mede) met het oog op reductie van micro-organismen.

  • Ccp

    Zie kritiek beheersingspunt

    Contract (in aanvulling op ISO)

    Daar waarin de ISO-norm contract staat, wordt hier bedoeld, hetgeen in paragraaf 4.3 "Normen en eisen" is gespecificeerd.

  • Doeldier

    Dier waarvoor een bepaald toevoeging- of diergeneesmiddel is bestemd.

  • Niet-doeldier

    Dier waarvoor een bepaald toevoeging- of diergeneesmiddel niet is bestemd.

  • Grondstoffenfile

    Tabel met informatie betreffende kenmerken van voedermiddelen zoals die door het mengvoederbedrijf worden gebruikt in de receptuur van een mengvoeder.

  • Lijst van gekende toevoeging- en diergeneesmiddelen (GMP21)

    Lijst van toevoeging- en diergeneesmiddelen voor verwerking in diervoeder, opgesteld door het productschap, waarvan de verwerkingseigenschappen adequaat en bekend zijn. Per middel wordt aangegeven welk residuniveau nog acceptabel is in:

    • diervoeders voor niet-doeldieren;

    • dierlijke producten van niet-doeldieren en;

    • dierlijke producten van doeldieren.

  • Kritiek beheersingspunt (CCP)

    Een punt, stap of procedure waarvoor tijdens de risico-analyse (gevarenevaluatie) is vastgesteld dat beheersing er van essentieel is om uit het oogpunt van voeder- en voedselveiligheid het risico te elimineren of te reduceren tot een aanvaardbaar niveau

  • Lijst van verboden voedermiddelen

    Zie hiervoor GMP 14

  • Lineaire programmering /formulatie diervoeders

    Programma dat wordt gebruikt voor de receptuurformulering van mengvoeders.

  • Partij

    Hoeveelheid van een product die een eenheid vormt en waarvan aangenomen wordt dat ze uniforme kenmerken bezit.

  • Punt van aandacht (PvA)

    Een risico dat beheerst wordt met algemene maatregelen, die voortvloeien uit procedures als het inkoopplan, reinigings- en ongedierte bestrijdingsplan, onderhoudsplan, enz.

  • Receptuur

    Document met te realiseren mengvoedersamenstelling.

  • Residuvorming

    Het optreden van residuen van toevoeging- en diergeneesmiddelen in diervoeders als gevolg van versleping. Verder het achterblijven / ophopen van resten van toevoeging- en diergeneesmiddelen in dierlijke producten (melk, vlees en eieren) van niet-doeldieren en doeldieren via overdracht vanuit diervoeders.

  • Risico

    De waarschijnlijkheid dat een bepaald potentieel gevaar (hazard) een negatief effect heeft.

  • Toevoegingmiddelen

    Toevoegingmiddelen als bedoeld in Richtlijn 70/524/EEG betreffende toevoegingsmiddelen in de diervoeding.

  • Versleping

    Component, verwerkt in een diervoeder dan wel toevoegingsmiddel, dat in een bepaalde mate achterblijft in het productieproces en daardoor terecht komt in een volgende charge diervoeder (mengvoeder, voormengsel) of toevoegingsmiddel.

  • Voormengsels

    In aanvulling op de definitie in Richtlijn 70/524/EEG betreffende toevoegingmiddelen in de diervoeding, wordt voorts onder voormengsels in deze GMP-standaard verstaan:

    toevoeging- en diergeneesmiddelen die rechtstreeks kunnen worden verwerkt in mengvoeders in een dosering van minimaal 0,5 dan wel 2 kg per 1000 kg of meer.

    gemedicineerde voormengsels en gemedicineerde halffabrikaten

  • Databank ongewenste stoffen (DOS)

    De databank van het productschap waarin analyseresultaten over de aanwezigheid van ongewenste stoffen en producten in diervoeder(middelen) zijn opgenomen.

  • Databank risicobeoordeling voedermiddelen (DRV)

    De databank van het productschap waarin verticale risicobeoordelingen van (enkelvoudige) voedermiddelen opgenomen zijn.

3.2. Doelgroepen [Vervallen per 01-01-2006]

De doelgroepen van deze GMP-standaard zijn: Ondernemers die mengvoeders, voormengsels, voedermiddelen toevoegingsmiddelen been verwerken, leveren aan derden, in de handel brengen, produceren, op- en overslaan, transporten of producten deze bestemming geven

De doelstelling van GMP-regeling is dat de productie, aflevering, op- en overslag en transport van mengvoeders, voedermiddelen, voormengsels en toevoegingsmiddelen aantoonbaar is geborgd, op een wijze dat de af te leveren producten voldoen aan de van toepassing zijnde wetgeving en normen.

4. Kwaliteitssysteem eisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

4.1.1. Kwaliteitsbeleid [Vervallen per 01-01-2006]

De directie stelt haar kwaliteitsbeleid, inclusief HACCP, en haar betrokkenheid bij kwaliteit vast en legt het schriftelijk vast.

De directie levert het bewijs van haar betrokkenheid bij het realiseren van de kwaliteitsdoelstellingen. Zij doet dit in ieder geval

door:

  • a) het belang om te voldoen aan weten regelgeving en de GMP-regeling kenbaar te maken binnen de organisatie;

  • b) het kwaliteitsbeleid vast te stellen;

  • c) een directieverklaring vast te stellen, die tenminste voldoet aan het model door het productschap vastgesteld;

  • d) te zorgen dat relevante kwaliteitsdoelstellingen zijn vastgesteld;

  • e) directiebeoordelingen uit te voeren; en de beschikbaarheid van middelen te bewerkstelligen.

De ondernemer is verplicht de onder c. bedoelde verklaring aan de certificatie-instelling te sturen.

Het kwaliteitsbeleid is gericht op productveiligheid en hygiëne van diervoeders en is afgestemd op de verwachtingen en behoeften van de afnemer. Er moet uit blijken dat de organisatie zich realiseert deel uit te maken van een voedselketen en passende maatregelen heeft genomen. De directie ziet toe op een correcte ontwikkeling, implementatie en onderhoud van het HACCP-systeem.

De reikwijdte en omvang van het HACCP- systeem moet worden aangegeven:

  • per product;

  • per proceslijn/-locatie;

  • de plaats in de keten.

Het is in principe niet toegestaan een gedeelte van de voortbrenging van diervoeders op eenzelfde locatie van het HACCP-systeem uit te zonderen.

Verder sluit het kwaliteitsbeleid aan bij de afspraken die in het kader van ketenprogramma's zijn gemaakt. De directie bewerkstelligt dat dit beleid op alle niveaus van de organisatie wordt begrepen, geïmplementeerd en onderhouden.

4.1.2. Organisatie [Vervallen per 01-01-2006]

4.1.2.1. Verantwoordelijkheid en bevoegdheid [Vervallen per 01-01-2006]

De verantwoordelijkheden, de bevoegdheden en de onderlinge betrekkingen van personeel dat leiding geeft aan werk, het uitvoert of het verifieert, dat van invloed is op de basiskwaliteit moeten schriftelijk worden vastgelegd.

Dit geldt in het bijzonder voor personeel dat de organisatorische vrijheid en bevoegdheid nodig heeft om:

  • a) de aanzet te geven tot actie ter voorkoming van afwijkingen van producten en diensten met betrekking tot basiskwaliteit, ook als die het gevolg zijn van het proces of het kwaliteitssysteem;

  • b) problemen met betrekking tot de basiskwaliteit te identificeren en te registreren;

  • c) de implementatie van oplossingen te controleren;

  • d) het verdere behandelen van afwijkende producten te organiseren zodat aan de normen van basiskwaliteit wordt voldaan.

De vaststelling en vastlegging van de verantwoordelijkheden en bevoegdheden dient in het kader van HACCP mede betrekking te hebben op het beheersen en borgen van de veiligheid van diervoeders.

De ondernemer legt de verantwoordelijkheidsstructuur vast in een organisatieschema.

4.1.2.2. Middelen [Vervallen per 01-01-2006]

Teneinde besmetting, kruisbesmetting en aantasting van kwaliteit van voortgebrachte producten te voorkomen draagt de ondernemer zorg voor bedrijfsruimten, installaties en gereedschappen: waarmee het risico van fouten wordt verlaagd; en die doeltreffend gereinigd en onderhouden kunnen worden

De ondernemer draagt zorg voor voldoende en gekwalificeerd personeel voor het leidinggeven, het uitvoeren van werkzaamheden en inspectieactiviteiten, waaronder interne kwaliteitsaudits.

4.1.2.3. Directievertegenwoordiger [Vervallen per 01-01-2006]

De directie moet een lid van het eigen management aanwijzen die, ongeacht andere verantwoordelijkheden, duidelijk omschreven bevoegdheid moet hebben om:

  • a) te bewerkstelligen dat een kwaliteitssysteem wordt opgezet, geïmplementeerd en onderhouden in overeenstemming met deze code, enb) te rapporten over het functioneren van het kwaliteitssysteem aan de directie, ter beoordeling van en als basis voor verbetering van het kwaliteitssysteem.

4.1.2.4. HACCP-team [Vervallen per 01-01-2006]

De directie stelt een HACCP-team in voor het instandhouden van het HACCP-systeem.

Aantoonbaar moet zijn dat het HACCP-team over voldoende expertise van uiteenlopende disciplines beschikt of kan beschikken als dit nodig is voor het opstellen en onderhoud van het HACCP- systeem. Van de samenstelling van de HACCP- teams moet de organisatie de minimale criteria voor teamleden vastleggen.

Bovendien moeten de functie (inclusief taken, verantwoordelijkheden en bevoegdheden) en de vereiste expertise van de teamleden zijn vastgelegd. Bij meerdere HACCP-teams moet er een coördinator zijn die de verantwoordelijkheid heeft over de voortgang, een correcte totstandkoming en onderhoud van het HACCP-systeem.

4.1.3. Beoordeling door de directie [Vervallen per 01-01-2006]

De directie moet het kwaliteitssysteem minimaal één keer per jaar beoordelen op doeltreffendheid en of voldaan kan worden aan de eisen van deze norm. Registraties van dergelijke beoordelingen worden bijgehouden (zie 4.16).

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

4.2.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer moet een kwaliteitssysteem opzetten, schriftelijk vastleggen en onderhouden als middel om te bewerkstelligen dat producten of diensten aan de normen voor basiskwaliteit voldoen. De ondernemer stelt een kwaliteitshandboek op dat de eisen van deze norm dekt.

In dit kwaliteitshandboek wordt in het kader van HACCP de wijze aangegeven waarop de organisatie de veiligheid van diervoeders waarborgt, inclusief de procesbeheersingsplannen.

Het kwaliteitshandboek moet de procedures van het kwaliteitssysteem omvatten of ernaar verwijzen en de structuur van de documentatie, die in het kwaliteitssysteem is gebruikt, uiteen zetten.

De punten waarop wordt afgeweken van de voorschriften van de GMP-standaard zijn genoemd.

4.2.2. Kwaliteitssysteem procedures [Vervallen per 01-01-2006]

  • a) De ondernemer heeft schriftelijk vastgelegde procedures die overeenstemmen met de eisen van de GMP-standaarden. Alle kritische punten in volgorde van het productieproces, die invloed hebben op de basiskwaliteit van het eindproduct of de dienst, inclusief veiligheid voor mens dier en milieu, zijn geïdentificeerd en vastgelegd.

  • b) Het kwaliteitssysteem en zijn schriftelijk vastgelegde procedures met taken, verantwoordelijkheden en bevoegdheden voor het personeel zijn op doeltreffende wijze geïmplementeerd. Dit geldt ook voor tijdelijk personeel.

De procedures, die deel uitmaken van het kwaliteitssysteem, zijn afgestemd op de ingewikkeldheid van het werk en het niveau van het betrokken personeel.

Indien is afgeweken van de GMP-standaard, wordt aantoonbaar gemaakt dat door andere maatregelen de basiskwaliteit op minimaal gelijkwaardige wijze wordt gewaarborgd. In ieder geval kan niet worden afgeweken van de wettelijke voorschriften en de in het kader van de GMP- regeling vastgelegde normen.

In het bedrijf is een persoon aangewezen, die verantwoordelijk is voor de actualiteit, het beheer en de verspreiding het handboek.

4.2.3. Kwaliteitsbeheersingsplan [Vervallen per 01-01-2006]

Het bedrijf legt een kwaliteitsbeheersingsplan vast. In dit plan is schriftelijk vastgelegd hoe de kritische punten, in volgorde van het voortbrengingsproces, worden beheerst. Alle relevante controles en inspecties zijn hierin vastgelegd.

Bij het opstellen van het kwaliteitsbeheersingsplan is aandacht besteed aan:

  • a) de verwijzing naar procedures en instructies voor bemonstering van producten, monsterbehandeling, inspecties en keuringen; b) frequentie van keuringen, bemonstering, inspecties en controles;

  • c) verantwoordelijke personen die keuringen, bemonstering, inspecties en controles uitvoeren;

  • d) uitrusting (keurings- en beproevingsmiddelen) en bekwaamheden, die nodig zijn om de basiskwaliteit te beheersen

  • e) gestelde eisen voor keuring en controle.

Minimaal dient voldaan te worden aan de door het productschap gesteld eisen omtrent te controleren parameters en frequentie.

4.2.4. Eindproductspecificaties1 [Vervallen per 01-01-2006]

Het kwaliteitssysteem bevat minimaal de specificaties van af te leveren diervoeders, toevoegingen diergeneesmiddelen, voormengsels en/of voedermiddelen.

Per product of productgroep moet er een productbeschrijving zijn waaruit de gevoeligheid voor veiligheidsrisico's blijkt. De beschrijving met betrekking tot de veiligheid van het product, moet een reikwijdte hebben vanaf onder andere de toegepaste componenten waaruit het product wordt samengesteld (bijvoorbeeld voedermiddelen, toevoegingsmiddelen en voormengsels) waaruit het product wordt samengesteld tot en met de distributie.

In de productspecificaties dienen minimaal te zijn opgenomen:

  • kenmerken van het product

  • kenmerken voor het gebruik

De kenmerken van het product omvatten minimaal een beschrijving van:

  • algemene gegevens (benaming, codering, etc.)',

  • samenstelling (chemisch, fysisch, microbiologisch)

  • gebruikte grond- en hulpstoffen

  • normen (wet- en regelgeving; afspraken met afnemers) en toleranties,

  • overige kenmerken (o.a. opslag, verpakking).

De kenmerken voor het gebruik omvatten minimaal een beschrijving van :

  • opslag- en bewaarcondities,

  • transport en aflevercondities,

  • houdbaarheid

Uit overwegingen van doelmatigheid mag worden gekozen voor het formeren van productgroepen. Belangrijk hierbij is dat:

  • specifieke verschillen tussen de afzonderlijke eindproducten kritisch worden bekeken;

  • de productie- en bewaarcondities daadwerkelijk gelijkwaardig zijn;

  • geen belangrijke aspecten m.b.t. productveiligheid worden vergeten

Bij levering van eindproducten aan een veehouder wordt aangegeven op welke wijze hij de geleverde producten dient op te slaan, zodat bederf, microbiologische besmetting e.d. wordt voorkomen. Tevens wordt hierbij aangegeven wat de houdbaarheidstermijn is onder de te onderscheiden opslagcondities bij de veehouder.

4.3. Normdocumenten [Vervallen per 01-01-2006]

4.3.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer draagt er zorg voor dat zijn producten en/of diensten aantoonbaar voldoen aan de normen ingevolge de GMP-regeling (GMP14).

De ondernemer dient te beschikken over alle relevante, wettelijk vereiste vergunningen, registraties en certificaties ingevolge de nationale en communautaire diervoederwetgeving.

Indien het transport van producten over de weg wordt verzorgd door een extern ingeschakeld transportbedrijf, dient dit bedrijf aantoonbaar aan de voorwaarden van de aanvullende GMP- standaard transport te voldoen. Vereist is dat deze transporteur beschikt over een certificaat. Uitgezonderd van de (certificatie-)voorwaarden ingevolge de GMP-regeling zijn extern ingeschakelde bedrijven die uitsluitend voor verpakte producten worden ingezet.

Indien de ondernemer opdracht verstrekt tot transport per binnenvaart, zeevaart of railvervoer zijn hiervoor de voorwaarden van GMP08a (binnenvaart), GMP08b (zeevaart) en GMP08c (railvervoer) van kracht.

In afwijking van het voorgaande is de opdrachtgever van transport van oliën en vetten en afgeleide producten voor rechtstreekse verwerking in diervoeder, dat aantoonbaar plaats vindt onder FOSFA-contract en waarbij de EU-1 lijst van aanvaardbare voorgaande ladingen bindend wordt gehanteerd, uitgesloten van verplichte certificatie voor GMP08B.

4.3.2. Aanvaarden van een opdracht (beoordeling) [Vervallen per 01-01-2006]

Voor het aanvaarden van een opdracht / bestelling wordt beoordeeld of deze aan de voorwaarden, bedoeld in par. 4.3.1 kan voldoen.

De ondernemer treft maatregelen en legt deze vast, opdat de bestelde producten worden (af)geleverd op de afgesproken plaats / silo.

4.3.3. Registraties [Vervallen per 01-01-2006]

Ten behoeve van tracering worden registraties van opdrachten en bestellingen van afnemers bewaard (zie 4.16).

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

Niet van toepassing

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

4.5.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer stelt een schriftelijk kwaliteitssysteem (GMP-handboek) op en legt dit vast om alle documenten en gegevens te beheren, die betrekking hebben op de van toepassing zijnde GMP-standaard.

Wijzigingen in de voor GMP relevante diervoederwetgeving' en/of GMP-regeling worden volgens een adequate werkwijze opgenomen in het kwaliteitssysteem.

4.5.2. Goedkeuring en uitgifte van documenten en gegevens [Vervallen per 01-01-2006]

Er is een procedure waarin de bevoegdheden zijn geregeld betreffende het goedkeuren en uitgeven van documenten en gegevens.

Voordat documenten en gegevens worden uitgegeven moeten deze door daartoe bevoegd personeel op geschiktheid zijn goedgekeurd.

Er is een procedure voor documentbeheer, die de geldende revisiestatus van documenten identificeert. Het doel hiervan is het gebruik van ongeldige en/of verouderde documenten te verhinderen. Dit kan een referentielijst zijn of een gelijkwaardig document.

Er is vastgelegd op welke wijze de actualisatie/beheersing van documenten voor dienstverleners, die van belang zijn voor de basiskwaliteit, is geregeld.

Elke pagina is voorzien van de datum van laatste wijziging.

Het beheer van het GMP-handboek moet bewerkstelligen dat:

  • de bijbehorende uitgaven van de juiste documenten beschikbaar zijn op alle locaties waar werkzaamheden worden uitgevoerd die van belang zijn voor het realiseren van basiskwaliteit;

  • ongeldige en/of verouderde documenten direct worden verwijderd van alle plaatsen waar ze zijn uitgegeven of worden gebruikt, of op een andere wijze verzekerd zijn tegen onbedoeld gebruik;

  • elk verouderd document dat voor wettelijke doeleinden en/of het op peil houden van kennis wordt bewaard, op passende wijze is geïdentificeerd.

4.5.3. Wijzigingen van documenten en gegevens [Vervallen per 01-01-2006]

Er is een procedure voor het wijzigen, aanpassen, aanvullen of herzien van de inhoud van het GMP- handboek. Deze procedure sluit aan op het gestelde in paragraaf 4.5.2.

Waar uitvoerbaar wordt de aard van de wijziging in het document geïdentificeerd.

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijk vastgelegde procedures om te bewerkstelligen dat met ingekochte producten aan de gespecificeerde eisen bedoeld in paragraaf 4.3 (basiskwaliteit) kan worden voldaan.

De ondernemer heeft aantoonbare afspraken met leveranciers en dienstverleners betreffende waarborging van de basiskwaliteit.

Minimaal dient voldaan te worden aan de specifieke aanvullende beheersmaatregelen in de andere GMP-standaarden, indien en voor zover van toepassing.

4.6.2. Het evalueren van toeleveranciers [Vervallen per 01-01-2006]

De ondernemer beschikt over geactualiseerde lijsten van toeleveranciers van producten en diensten die voor de realisatie van basiskwaliteit van belang zijn.

De ondernemer evalueert minimaal jaarlijks de toeleveranciers van producten en diensten. De evaluatie heeft betrekking op hun vermogen om te voldoen aan de gemaakte afspraken en de geschiktheid van de geleverde producten voor het realiseren van basiskwaliteit in de af te leveren producten of diensten.

Er zijn minimaal lijsten van toeleveranciers van producten (bijvoorbeeld voedermiddelen, hulpstoffen, voormengsels, toevoegingmiddelen, diergeneesmiddelen, diervoeders) en diensten (graanfactor, op- en overslag, transport, etc.)

Van bovenstaande evaluaties van toeleveranciers zijn registraties aanwezig (zie paragraaf 4.16).

4.6.3. Inkoopgegevens [Vervallen per 01-01-2006]

Het GMP-handboek bevat minimaal specificaties van de te ontvangen diervoeders, voedermiddelen, voormengsels, toevoeging- en diergeneesmiddelen, en overige hulpstoffen indien van toepassing. Voordat nieuwe voedermiddelen, hulpstoffen of producten worden aangekocht, worden specificaties opgesteld en vrijgegeven door bevoegde personen. Deze specificaties zijn opgesteld op basis van een uitgevoerde risicobeoordeling van de producten.

De ondernemer heeft een deugdelijke administratie waarin is opgenomen:

  • a) de hoeveelheden en soorten ontvangen grond- en hulpstoffen, voedermiddelen, hulpstoffen, diervoeders en voormengsels per toeleverancier;

  • b) de eventuele geleide documenten, garantieverklaringen, certificaten e.d. die partijen voedermiddelen, diervoeders of voormengsels begeleiden.

4.6.4. Verificatie van ingekochte producten [Vervallen per 01-01-2006]

Indien diervoeders, voedermiddelen en andere grond- en hulpstoffen door derden (transporteurs en graanfactors) worden ontvangen, zijn de afspraken om de basiskwaliteit van de aangekochte producten overeenkomstig de GMP-regeling te borgen schriftelijk vastgelegd.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

Voedermiddelen, halffabrikaten, hulpstoffen en toevoegingmiddelen die door de afnemer worden aangeleverd voor verwerking in zijn producten, dienen aan een gelijke ontvangstcontrole onderworpen te zijn als de door de ondernemer aangekochte producten.

Diergeneesmiddelen worden verwerkt op attest van dierenartsen. De ondernemer ziet erop toe dat alleen wettelijk geregistreerde diergeneesmiddelen worden verwerkt volgens de aanwijzingen op verpakking.

4.8. Identificatie en naspeurbaarheid [Vervallen per 01-01-2006]

De administratie van de ondernemer is zodanig dat afgeleverde producten traceerbaar zijn tot ontvangst van voedermiddelen, hulpstoffen, toevoegingmiddelen en diergeneesmiddelen. De mate van naspeurbaarheid ten behoeve van het kunnen traceren en terugroepen van producten wordt vastgelegd.

Het bestuur kan bij besluit nadere voorwaarden aan de naspeurbaarheid (tracking & tracing) stellen. De ondernemer is gehouden deze voorwaarden ten minste na te leven (GMP 27).

Registraties in dit kader worden bewaard (zie 4.16).

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Algemeen [Vervallen per 01-01-2006]

Het productie- en voortbrengingsproces is beschreven conform de reikwijdte van het systeem. Voor het beheersen van kritieke beheersingspunten zijn procedures en instructies opgesteld, voor het beheersen van de basiskwaliteit van de producten.

Er wordt minimaal voldaan aan de onder dit hoofdstuk beschreven punten, alsmede de aanvullende beheersmaatregelen in de andere bijlagen bij deze GMP-regeling indien van toepassing.

4.9.1.1. Processchema 's [Vervallen per 01-01-2006]

De beschrijving van het productie- en voortbrengingsproces is tenminste ook neergelegd in de vorm van processchema's en/of flowdiagrammen, waar van toepassing vanaf inkoop tot en met aflevering. Deze beschrijving is opgesteld en geverifieerd door het HACCP-team. In deze schema's wordt de wijze van beheersing van het proces uit oogpunt van veiligheid aangegeven. De schema's moeten alle relevante processtappen omvatten.

De verificatie van de processchema's moet bij elke wijziging in de processen herhaald worden, opdat wijzigingen en/of vernieuwingen in het voortbrengingsproces tijdig kunnen worden vastgelegd en beoordeeld m.b.t. de risico's over de productveiligheid. De uitvoering van de verificatie moet in een plan zijn vastgelegd.

4.9.1.2. Bedrijfsinrichting [Vervallen per 01-01-2006]

De bedrijfsinrichting is zodanig dat verschillende producten niet onbedoeld met elkaar in contact kunnen komen, zodat kruisbesmetting of onbedoelde vermenging wordt voorkomen. De ruimtelijke indeling van opslag is zodanig dat aantoonbaar geen verwarring van verschillende producten kan plaatsvinden bij gebruik of aflevering. De productie-een heden, opslagruimtes en personele voorzieningen worden aangegeven in een plattegrond. Waar van toepassing wordt in de plattegrond aangegeven waar kruisbesmettingen mogelijk zijn.

De plattegrond moet bij wijzigingen aangepast worden. Dit moet geverifieerd worden. De uitvoering van de verificatie moet in een plan zijn vastgelegd.

Diervoeders, voedermiddelen, voormengsels, toevoegingmiddelen en diergeneesmiddelen dienen op hygiënische wijze opgeslagen te worden, zo-

danig dat geen microbiologische besmetting optreedt. Voorts dient de toename van het aantal micro-organismen tijdens opslag voorkomen te worden.

Bedrijfsruimten waarin voedermiddelen, mengvoeders, voormengsels, toevoegingmiddelen of diergeneesmiddelen zijn opgeslagen, zijn alleen toegankelijk voor de door de directie daartoe geautoriseerd personeel.

Er is een zodanige fysieke en organisatorische scheiding tussen producten, die enerzijds bestemd zijn voor de bereiding of aanwending in de diervoedersector én anderzijds afvalstoffen dat onderlinge vermenging is uitgesloten.

4.9.1.3. Vogels, huisdieren en ongedierte [Vervallen per 01-01-2006]

In bedrijfsruimten dienen maatregelen ter wering van vogels, huisdieren en ongedierte genomen te worden. Bij het aanwezig zijn van vogels en ongedierte worden maatregelen getroffen. Ook huisdieren dienen niet in bedrijfsruimten aanwezig te zijn.

Bij het toepassen van bestrijdingsprogramma's ter wering van vogels en ongedierte dienen, zowel uit oogpunt van veiligheid van werknemers, als uit oogpunt van kwaliteit van diervoeder acceptabele bestrijdingsmethoden en -middelen te worden gebruikt. De toegepaste bestrijdingsprogramma's dienen vastgelegd te zijn.

4.9.2. Gevaren, risico's en beheersmaatregelen [Vervallen per 01-01-2006]

4.9.2.1. Gevaren-identificatie [Vervallen per 01-01-2006]

De organisatie (HACCP-team) moet de potentiële gevaren identificeren en analyseren van alle voortbrengingsprocessen.

Deze identificatie en gevaren analyse moet bij de juridische eigenaar van het product alle aspecten van het productieproces omvatten die de productveiligheid negatief kunnen beïnvloeden door (micro-) biologische, (bio-) chemische en fysische gevaren.

Bij dienstverlenende organisaties (niet-juridische eigenaar, maar houder/bezitter van het product) beperkt de gevaren analyse zich echter tot de uitgevoerde diensten.

In de analyse moeten alle aspecten betreffende het hele toepassingsgebied van het HACCP-plan worden beschreven.

4.9.2.2. Risicobeoordeling [Vervallen per 01-01-2006]

Door de organisatie (HACCP-team) moet een risico beoordeling per geïdentificeerd gevaar worden uitgevoerd.

De resultaten van de risicobeoordelingen moeten vastgelegd worden, waarbij de basis/uitgangspunten waarop de risico's zijn gewogen/ingeschat aangegeven moet(en) zijn. Het bedrijf moet daarvoor acceptabele niveaus van de gevaren vaststellen en de normen moeten minimaal voldoen aan de wettelijke veiligheidseisen/normen. Bij de uitvoering van de risicobeoordeling moet, voor zover van toepassing, gebruik gemaakt worden van (praktische) ervaringen, experimentele gegevens, literatuur, etc.

Van elke soort aan te kopen dan wel te ontvangen product diervoeder, voedermiddel, voormengsels, toevoegingen diergeneesmiddel, en overige grond- en hulpstoffen die in de producten worden verwerkt dient een risicobeoordeling aantoonbaar beschikbaar te zijn.

Indien het een product betreft, waarvan geen risicobeoordeling in de Databank Risicobeoordeling Voedermiddelen van het productschap aanwezig is, dient de ondernemer eerst een risicobeoordeling aan het productschap aan te bieden voor opname in de bedoelde databank. Pas na opname door het productschap in de databank kan het product worden aangekocht dan wel worden ontvangen. Tevens dient het bij de certificerende instelling als hiervoor bedoeld te worden gemeld.

4.9.2.3. Beheersmaatregelen [Vervallen per 01-01-2006]

Er dienen beheersmaatregelen vastgesteld en vastgelegd te worden die naar aanleiding van de gevaren- en risico-beoordeling zijn of worden ingevoerd voor de eliminatie of reducering van risico's tot een aanvaardbaar/acceptabel niveau. Deze beheersmaatregelen moeten, voor zover van toepassing, zijn vastgelegd.

4.9.2.4. Beoordeling kritieke beheersingspunten [Vervallen per 01-01-2006]

Door het HACCP-team moet een beoordeling zijn uitgevoerd van iedere processtap. De beoordeling van het team moet daarbij gebaseerd zijn op onder andere de expertise van de verschillende disciplines in het team en het gebruik van externe en interne informatie.

Per processtap moeten de aspecten aangegeven zijn waarop men beoordeeld heeft en er dient een motivering te worden weergegeven waaruit blijkt of er wel of niet sprake is van een CCP.

Aangegeven moet worden of een preventieve maatregel als kritiek beheersingspunt (CCP) moet worden beschouwd of als punt van aandacht (PVA) en of het in de verificatie-procedure moet worden opgenomen.

4.9.3. Bedrijfshygiëne en documentatie [Vervallen per 01-01-2006]

De ondernemer dient zodanige maatregelen vast te stellen en uit te voeren, dat een adequate bedrijfshygiëne wordt verzekerd. Bedrijfsreinigingsprogramma's dienen schriftelijk vastgelegd te zijn, waarbij methoden, frequentie) en tijdstippen zijn vermeld.

Productie- en opslagvoorschriften, die betrekking hebben op de kritische punten die van belang zijn om de vereiste microbiologische kwaliteit te realiseren, worden vastgesteld. Deze worden ter beschikking gesteld van het voor opslag van voedermiddelen en de productie van diervoeders verantwoordelijke personeel.

Alle protocollen, documenten, procedures en instructies in verband met de hygiënische productie van diervoeders dienen in het GMP-handboek te zijn opgenomen.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Algemeen [Vervallen per 01-01-2006]

Per processtap moeten de van toepassing zijnde normen (streefwaarden) en toleranties (grenswaarden) worden vastgesteld en vastgelegd. Voor elk kritiek beheersingspunt (CCP) moeten de te meten en de te observeren parameters worden vastgesteld. Hieraan dienen de normen en toleranties te worden toegekend. Verder moet aangegeven zijn waaraan de waarden zijn ontleend en hoe de waarden zijn bepaald (gevalideerd).

Bij het vaststellen van deze streef- en grenswaarden moet worden voldaan aan relevante wet- of regelgeving. Deze waarden en/of uitkomsten van interne risico-beoordeling moeten worden beschouwd als (contractuele) verplichtingen. Er wordt daarvoor een passende werkwijze vastgesteld en bijgehouden met betrekking tot het beheer en de toepassing van de relevante normen en toleranties.

Alle benodigde inspecties en controles op de kritische punten in het voortbrengingsproces (vanaf grondstof tot eindproduct) en de vast te stellen registraties zijn in detail beschreven. Deze punten moeten worden gecontroleerd en geïnspecteerd, volgens de vastgelegde instructies.

Keuringen, controles en metingen worden uitgevoerd met behulp van geëigende methoden en apparatuur.

De wijze en frequentie van monstername en de uit te voeren analyses zijn gebaseerd op de risicobeoordelingen en worden vastgelegd, en zijn minimaal overeenkomstig de ingevolge de GMP- regeling vastgestelde voorwaarden en voorschriften m.b.t. monitoring.

4.10.2. Ingangskeuring en -beproeving [Vervallen per 01-01-2006]

Bij de in ontvangstname van producten vindt een ingangskeuring plaats.

Er vindt een verificatie plaats dat de te ontvangen producten voldoen aan de gestelde eisen, alsmede dat is voldaan aan de transporteisen.

Indien een te ontvangen partij van een product na keuring wordt geweigerd omdat niet voldaan wordt aan de normen ingevolge de GMP-regeling, stelt het bedrijf het productschap daarvan ingevolge de procedure als bedoeld in par. 4.14 onverwijld op de hoogte, zodat het productschap in staat is andere bedrijven en certificerende instellingen daarvan in kennis te stellen.

4.10.3. Tussentijdse keuring en beproeving [Vervallen per 01-01-2006]

De ondernemer draagt er zorg voor dat:

  • alle onderdelen van het voortbrengingsproces en/of de gebruikte voedermiddelen, moeten worden gecontroleerd en geïnspecteerd volgens vastgelegde instructies;

  • daar waar voor bepaalde voedermiddelen en hulpstoffen eisen aanwezig zijn met betrekking tot toelaatbare opslagduur en/of condities zijn deze vastgelegd en worden deze bewaakt en gecontroleerd;

    • indien van toepassing het product vasthouden tot de vereiste keuring en beproevingen zijn uitgevoerd.

4.10.4. Hygiëne inspecties [Vervallen per 01-01-2006]

De ondernemer draagt er zorg voor dat periodiek inspecties worden uitgevoerd op:

  • a) de hygiënische omstandigheden van de bedrijfsinrichting;

  • b) de kritische punten in het productieproces/handeling;

  • c) het functioneren van de in het productieproces aangebrachte meetapparatuur;

  • d) het voldoen aan de door het bedrijf vastgestelde procescondities.

4.10.5. Eindkeuring en -beproeving [Vervallen per 01-01-2006]

Producten mogen niet worden vrijgegeven voor aflevering tot alle activiteiten, die in het kwaliteitsbeheersingsplan zijn vastgelegd, naar tevredenheid zijn afgerond.

4.10.6. Registraties van keuringen en beproevingen [Vervallen per 01-01-2006]

De resultaten van controles, metingen en inspecties worden vastgelegd in daarvoor ontwikkelde controle- en inspectieformulieren. Uit de registraties blijkt duidelijk wie de keuringen en beproevingen heeft uitgevoerd.

Indien monsters worden genomen, draagt de ondernemer zorg voor een adequate identificatie en bewaring van de monsters gedurende de passende periode.

Desgevraagd is hij gehouden om deze gegevens aan het productschap ter beschikking te stellen.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen. [Vervallen per 01-01-2006]

4.11.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijke procedures voor de beheersing, de kalibratie en het onderhoud van keurings-, meet- en beproevingsmiddelen die worden gebruikt om basiskwaliteit aantoonbaar te maken. Keurings-, meet- en beproevingsmiddelen worden gebruikt op een wijze die bewerkstelligt dat de vereiste meetcapaciteit is afgestemd op de meetonzekerheid.

De analyses met betrekking tot basiskwaliteit worden uitgevoerd door een ingevolge de GMP- regeling gecertificeerd laboratorium.

De ondernemer heeft vastgelegd welke laboratoria de voor de GMP-regeling relevante bepalingen uitvoeren.

4.11.2. Beheersingsprocedure [Vervallen per 01-01-2006]

De ondernemer draagt er zorg voor dat:

  • alle keurings-, meet- en beproevingsmiddelen die van invloed zijn op de basiskwaliteit, geregistreerd zijn;

  • de methoden en apparaten voor controle en metingen met passende en vastgelegde frequenties volgens vastgelegde procedures worden gekalibreerd;

  • de criteria waaraan de te kalibreren keurings-, meet of beproevingsmiddelen voldoen, vastgelegd zijn;

  • de inspecties worden uitgevoerd met gestandaardiseerde checklijsten (zie ook 4.16);

  • van de voor de controles te gebruiken meetmethoden beschrijvingen (eventueel met een verwijzing naar relevante literatuurplaatsen of regelingen) aanwezig zijn;

  • alle weegschalen, die gebruikt worden voor de dosering van voedermiddelen en ingrediënten voor diervoeder, minimaal éénmaal per jaar gekalibreerd worden. Weegapparatuur die gebruikt wordt voor het wegen / doseren van voormengsels, toevoeging- en diergeneesmiddelen dienen minimaal tweemaal per jaar gekalibreerd te worden volgens een door het bedrijf zelf vastgestelde methode die voldoende adequaat is om de doelstellingen van de GMP-regeling te bereiken.

4.12. Keurings-en beproevingsstatus [Vervallen per 01-01-2006]

De keurings- en beproevingsstatus (vrijgave of blokkering) van producten is geïdentificeerd met behulp van passende middelen.

Producten die niet geschikt zijn voor aflevering, zijn voor iedereen duidelijk herkenbaar gemaakt.

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

4.13.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer heeft een schriftelijke procedure vastgelegd hoe omgegaan dient te worden met producten en/of diensten die niet voldoen aan de eisen in relatie met de basiskwaliteit, of door welke niet voldaan wordt aan de gestelde normen en eisen. Deze beheersing moet voorzien in identificatie, documentatie, evaluatie, scheiding (indien praktisch uitvoerbaar), afhandeling van producten met afwijkingen en in het op de hoogte stellen van de betrokkenen, zowel intern als extern.

4.13.2. Beoordeling en afhandeling van producten met afwijkingen [Vervallen per 01-01-2006]

De verantwoordelijkheid voor de beoordeling en de bevoegdheid voor de afhandeling van producten met afwijkingen moeten worden gedefinieerd.

Producten met afwijkingen moeten volgens (schriftelijk) vastgelegde procedures worden beoordeeld. Ze mogen:

  • a) worden herbewerkt om aan de gespecificeerde eisen te voldoen;

  • b) opnieuw voor alternatieve toepassingen worden geclassificeerd; of

  • c) worden afgekeurd of vernietigd.

Indien producten niet meer geschikt zijn als diervoeder(middel) dienen zij afgevoerd te worden naar een bestemming die in overeenstemming is met de bepalingen in de van toepassing zijnde wetgeving.

4.13.3. Terughalen geleverde producten [Vervallen per 01-01-2006]

De ondernemer is verplicht om onverwijld, indien een product is afgeleverd, dat niet voldoet aan de wettelijke voorwaarden m.b.t. veiligheid, deugdelijke handelskwaliteit (als bedoeld in artikel 2 van de Verordening PDV certificatie GMP diervoedersector 2003; GMP00) of de essentiële voorwaarden van de GMP-regeling, de volgende acties te ondernemen:

  • informeren van de klant,

  • (laten) blokkeren van het product,

  • terughalen van het product en zorg dragen dat het product buiten de diervoeder- en veehouderijsector blijft

tenzij de ondernemer ten genoegen van de certificatie-instelling kan aantonen dat de tekortkoming zonder nadelige gevolgen is voor de gezondheid van dier en mens en waarbij de wettelijke normen niet worden overschreden.

De ondernemer stelt daartoe een protocol en een procedure vast.

Tenminste dient voldaan te worden aan de door het bestuur van het productschap gestelde eisen aan het protocol en de procedure voor het terughalen van producten.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

4.14.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijk procedures vastgesteld en houdt deze bij voor corrigerende en preventieve maatregelen. De corrigerende en preventieve maatregelen zijn erop gericht te voldoen aan basiskwaliteit en de genoemde normen in paragraaf 4.3.

De ondernemer moet elke wijziging in de (schriftelijk) vastgelegde procedures die voortkomt uit corrigerende en preventieve maatregelen, implementeren en registreren.

4.14.2. Corrigerende maatregelen [Vervallen per 01-01-2006]

De procedures voor corrigerende maatregelen houden in:

  • a) een doeltreffende behandeling van klachten en afwijkingen;

  • b) onderzoek naar de oorzaak van afwijkingen;

  • c) het bepalen van de corrigerende maatregelen;

  • d) een controle op het functioneren van de corrigerende maatregel.

4.14.3. Preventieve maatregelen [Vervallen per 01-01-2006]

De procedures voor preventieve maatregelen houden in:

  • het signaleren van potentiële oorzaken van afwijkingen, deze te analyseren en weg te nemen;

  • het vaststellen van de stappen die nodig zijn voor het aanpakken van enig probleem dat preventieve maatregelen vereist;

  • het bepalen van preventieve maatregelen;

  • en controle of het gewenste resultaat wordt bereikt.

4.14.4. Early warning procedure [Vervallen per 01-01-2006]

De ondernemer heeft een procedure voor het (vroeg)tijdig signaleren en behandelen van signalen, die er op duiden dat de veiligheid van een product niet in overeenstemming is met de wettelijke dan wel in de GMP-regeling vastgelegde normen, en die tot schade kan leiden voor afnemers in de keten. Op grond hiervan worden signalen beoordeeld, en desgewenst worden beheersmaatregelen genomen ter voorkoming of beheersing van het gesignaleerde gevaar. Dit laat onverlet dat er een meldingsplicht geldt voor overschrijding van wettelijk vastgestelde normen.

Indien het een potentieel gevaar is, dat niet door de betreffende onderneming beheerst kan worden en anderen (ook) kan schaden, is de ondernemer verplicht het productschap te informeren. Daarbij dient het door het bestuur van het productschap vastgestelde early warning protocol in acht te worden genomen.

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

4.15.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijk vastgelegde procedures en houdt deze bij voor behandeling, opslag, verpakking, conservering en aflevering van producten.

De wettelijke vermeldingen zijn duidelijk aangegeven op de verpakking of de begeleidende documenten.

4.15.2. Behandeling [Vervallen per 01-01-2006]

De ondernemer moet in methoden van behandeling van het product voorzien die beschadiging of achteruitgang voorkomen.

Vermengen van verschillende producten (dus niet van partijen van hetzelfde product of producten die uit éénzelfde productieprocesgang2 komen) mag uitsluitend indien de betreffende ondernemer over een certificatie ingevolge de GMP-regeling voor de productie en handel van mengvoeders beschikt en de productspecificatie is opgenomen.

4.15.3. Opslag [Vervallen per 01-01-2006]

In afwachting van aflevering worden eindproducten opgeslagen in aangewezen opslagsilo's of opslagruimtes. Beschadiging of achteruitgang dient voorkomen te worden. Ter voorkoming van kruisbesmetting of onbedoelde vermenging in silo's en opslagruimtes, is de vrijgave van silo's eenduidig vastgelegd.

Om achteruitgang te ontdekken moet de toestand van producten die in voorraad zijn met geschikte tussenpozen worden beoordeeld.

4.15.4. Verpakking [Vervallen per 01-01-2006]

De aflevering van buikproducten vindt plaats in droge schone transportmiddelen, zodat af te leveren partijen niet besmet raken. Als producten in zakgoed of anderszins verpakt worden afgeleverd, is de verpakking afgestemd op het beheersen van de normen voor basiskwaliteit.

4.15.5. Conservering [Vervallen per 01-01-2006]

De ondernemer heeft geschikte methoden voor conservering en scheiding van producten. Zie ook 4.15.3

4.15.6. Aflevering [Vervallen per 01-01-2006]

Indien producten worden afgeleverd zijn de volgende maatregelen getroffen voor bescherming van de basiskwaliteit:

  • De transportvolgorde van producten is traceerbaar gedurende de vereiste bewaartermijn (zie 4.16);

  • De ondernemer dient bij de transportopdracht informatie m.b.t. de productcategorieën, incl. GMP- standaarden in het kader van transport te verstrekken zoals in de GMP-regeling is vastgesteld;

  • De ondernemer verifieert voor belading van het transportmiddel waar dit technisch en/of organisatorisch mogelijk is of de laadruimte schoon is, vrij van ladingsrestanten en van geur van voorgaande ladingen. Waar het in redelijkheid niet mogelijk is om de controle routinematig uit te voeren wordt steekproefsgewijs voor belading controle uitgeoefend op deze reinheidseis. Van deze verificaties worden registraties bijgehouden.

Wanneer de afnemer opdrachtgever is van het transport en de laadruimte voldoet niet aan bovengenoemde reinheidseis, legt de ondernemer dit ter beoordeling voor aan de afnemer, alvorens hij de belading laat starten. Van het oordeel van de afnemer wordt een registratie bijgehouden.

Bij franco leveringen treft de ondernemer maatregelen en legt deze vast die de zekerheid bieden dat de bestelde producten bij de betrokken afnemer worden afgeleverd, op de juiste opslagplaats/in de juiste silo.

Vochtrijke producten (m.u.v. technologische hulpstoffen) afkomstig van levensmiddelenbedrijven, fermentatiebedrijven en farmaceutische bedrijven die ingevolge de GMP-regeling gecertificeerd zijn, mogen slechts worden afgeleverd, indien deze producten rechtstreeks van een productiebedrijf naar een veehouderijbedrijf of naar een GMP - gecertificeerde mengvoederfabrikant worden getransporteerd. Onder rechtstreeks transport wordt ook verstaan collecterende tussenopslag van leveranties van hetzelfde oorspronkelijke productiebedrijf van hetzelfde product in silo's, tanks e.d. die door de ondernemer zelf worden beheerd. Vermenging tijdens tussenopslag of transport van verschillende (soorten) vochtrijke producten onderling of van hetzelfde vochtrijke product, afkomstig van verschillende productiebedrijven, is niet toegestaan, tenzij voldaan wordt aan het gestelde in 4.15.2.

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijk vastgelegd op welke wijze (kwaliteits) registraties worden geïdentificeerd, verzameld, geïndexeerd, gearchiveerd en opgeslagen.

Kwaliteitsregistraties worden bijgehouden om aan te tonen dat voldaan is/wordt aan de normen voor basiskwaliteit. Kwaliteitsregistraties worden zodanig opgeslagen en bewaard dat ze gemakkelijk terug te vinden zijn.

De resultaten van de inspecties en controles, alsmede de administratie en registratie met betrekking tot kritische punten worden minimaal drie jaren bewaard, tenzij in het kader van wettelijke of andere regelingen een langere bewaartermijn is vereist.

De ondernemer maakt ieder kwartaal een overzicht van de uitgevoerde analyses in het kader

van de controle op basiskwaliteit. Dit overzicht is beschikbaar voor het productschap.

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

De ondernemer heeft schriftelijke procedures vastgesteld voor het plannen en uitvoeren van interne audits. Het doel van deze audits is vast te stellen of het kwaliteitsysteem functioneert en aan de normen voor basiskwaliteit wordt voldaan.

Interne kwaliteitsaudits worden minimaal jaarlijks gepland en uitgevoerd door personeel dat onafhankelijk is van degenen die direct verantwoordelijk zijn voor de activiteit waarop de audit wordt uitgevoerd.

De resultaten van de audits worden geregistreerd en onder de aandacht gebracht van het personeel dat de verantwoordelijkheid draagt in het gebied waarop de audit wordt uitgevoerd. Ten aanzien van onvolkomenheden die gedurende de audit worden geconstateerd, moeten tijdig corrigerende maatregelen worden genomen. De implementatie en de doeltreffendheid van de genomen corrigerende maatregelen worden geverifieerd en geregistreerd.

4.18. Opleiding [Vervallen per 01-01-2006]

Het personeel moet voldoende kennis en vaardigheden hebben voor de aan hen opgedragen taken in het kader van de realisering van basiskwaliteit. Er is een passende registratie van ervaring, vaardigheden en (benodigde) opleidingen van betrokken medewerkers.

Met betrekking tot HACCP geldt in het bijzonder dat concrete aandacht besteed wordt in het opleidingsplan aan het vergroten van kennis van en bewustzijn met betrekking tot veiligheid van diervoeders. Dit geldt minimaal voor alle leden van het HACCP-team, maar mogelijk ook voor ander uitvoerend personeel.

In ieder geval heeft het ter zake betrokken personeel voldoende kennis en vaardigheid om op hygiënische wijze producten te produceren, die bestemd worden tot diervoeder. De taken en verantwoordelijkheden met betrekking tot hygiënische productie en microbiologische kwaliteit van diervoeder dienen schriftelijk en duidelijk kenbaar gemaakt te zijn.

Indien een ondernemer (voormengsels met) toevoegmiddelen en/of diergeneesmiddelen produceert, verhandelt, ontvangt, be- of verwerkt dient de vakbekwaamheid ter zake van het betrokken personeel op peil te worden gehouden. Voor de

verwerking van (voormengsels met) toevoeging- en/of diergeneesmiddelen zijn instructies beschikbaar gesteld. Het veilig werken (met voormengsels) met toevoeging- en diergeneesmiddelen dient zodanig te zijn vastgelegd dat het personeel hier goed kennis van kan nemen.

4.20. Statistische technieken [Vervallen per 01-01-2006]

4.20.1. Identificatie van behoefte [Vervallen per 01-01-2006]

De ondernemer moet de behoefte aan statistische technieken identificeren die voor het vaststellen, beheersen en verifiëren van basiskwaliteit vereist zijn, voor zover deze niet in deze standaard genoemd zijn.

4.20.2. Procedures [Vervallen per 01-01-2006]

De ondernemer moet (schriftelijk) vastgelegde procedures vaststellen en bijhouden voor het implementeren en beheersen van de toepassing van de in 4.20.1 geïdentificeerde statistische technieken.

02. GMP-standaard handel en productie mengvoeders GMP02; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

  4.3.1 Toevoegings- en diergeneesmiddelen 3
  4.3.2 Hygiënisch werken 3
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

3

  4.6.1 Algemeen 3
  4.6.2 Toevoegings- en diergeneesmiddelen 4
  4.6.3 Ongewenste stoffen en producten 4
  4.6.4 Hygiënisch werken 4
 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

4

  4.9.1 Toevoegings- en diergeneesmiddelen 4
  4.9.2 Ongewenste stoffen en producten 6
 

4.10

Keuring en Beproeving

6

  4.10.1 Ontvangst toevoeging- en diergeneesmiddelen 6
  4.10.2 Hygiëne inspecties 7
  4.10.3 Kwaliteitscontroles 7
 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

7

 

4.12

Keurings- en Beproevingsstatus

7

 

4.13

Beheersing van Producten met Afwijkingen

7

  4.13.1 Hygiënisch werken

7

  4.13.2 Andere behandeling 7
 

4.14

Corrigerende en preventieve Maatregelen

7

  4.14.1 Hygiënisch werken 7
 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

8

  4.15.1 Toevoegings- en diergeneesmiddelen 8
  4.15.2 Hygiënisch werken 8
 

4.16

Beheersing van Kwaliteitsregistraties

8

 

4.17

Interne Kwaliteitaudits

8

 

4.18

Opleiding

8

 

4.19

Nazorg

8

  4.19.1 Toevoegings- en diergeneesmiddelen 8
  4.19.2 Hygiënisch werken 8
 

4.20

Statistische Technieken

8

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling voor de producenten van en handelaren in mengvoeders op de algemene GMP-standaard diervoedersector (GMP01) De Algemene GMP- standaard diervoedersector (GMP01) is integraal van toepassing.

Indien de ondernemer verrichtingen uitvoert waarvoor een andere aanvullende GMP- standaard bestaat (b.v. voor op- en overslag, transport, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

Het kwaliteitsysteem voldoet aan de voorwaarden als vermeld in de algemene GMP- standaard voor de diervoedersector.

4.3. Normen [Vervallen per 01-01-2006]

4.3.1. Toevoegings- en diergeneesmiddelen [Vervallen per 01-01-2006]

Het maximaal aanvaardbare verschil tussen gedeclareerd en geanalyseerd gehalte van toevoegings- en diergeneesmiddelen is vastgelegd. Deze dient minimaal aan de wettelijk vastgestelde tolerantie te voldoen.

4.3.2. Hygiënisch werken [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem wordt gehanteerd, dat aantoonbaar wordt voldaan aan de wettelijke eisen en de normen in de GMP-regeling en dat de handeling van mengvoeders op hygiënische wijze plaatsvindt, waardoor de microbiologische kwaliteit wordt beheerst.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Documenten- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Algemeen [Vervallen per 01-01-2006]

Indien de ondernemer de mengvoeders niet zelf produceert, dienen deze betrokken te worden bij GMP-gecertificeerde bedrijven.

De ondernemer koopt uitsluitend voedermiddelen van leveranciers die gecertificeerd zijn, waarbij aantoonbaar op het moment van levering minimaal aan het volgende wordt voldaan:

  • 1. De leverancier is een GMP-gecertificeerde handelaar in of producent van voedermiddelen (GMP04/GMP05).

  • 2. De leverancier, zijnde een akkerbouwer, is een GMP-gecertificeerde teler ingevolge de GMP-standaard teelt van voedermiddelen (GMP-11), of volgens een daarmee door het productschapuitwisselbaar verklaarde kwaliteitsstandaard3.

  • 3. Indien de ondernemer van een leverancier in het buitenland afneemt die niet aan het voorgaande voldoet, dient de ondernemer te voldoen aan de aanvullende voorwaarden voor de GMP-standaard voor de handelaren van voedermiddelen GMP05).

Voedermiddelen4 die niet in eigen locatie worden op- en overgeslagen, zijn op- en overgeslagen bij GMP-gecertificeerde op- en overslagbedrijven.

4.6.2. Toevoegings- en diergeneesmiddelen [Vervallen per 01-01-2006]

Voormengsels met toevoegingmiddelen worden betrokken van een GMP-gecertificeerde voormengselleverancier.

Toevoegingsmiddelen, die rechtstreeks kunnen worden verwerkt in mengvoeders dienen door een GMP-gecertificeerde leverancier van toevoegingsmiddelen te worden geleverd5.

Diergeneesmiddelen die rechtstreeks kunnen worden verwerkt in mengvoeders in een dosering van minimaal 0,5 dan wel 2 kg per 1000 kg of meer, en rechtstreeks worden geleverd door de leverancier van diergeneesmiddelen behoeven niet door een GMP-gecertificeerde leverancier te worden geleverd6.

4.6.3. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Indien voedermiddelen worden aangekocht die maximumnormen voor ongewenste stoffen en producten voor enkelvoudige vervoedering als bedoeld in Richtlijn 1999/29/EG inzake ongewenste stoffen en producten in diervoeding overschrijden, dan dient in aanvulling op de wettelijke voorschriften inzicht bij de mengvoederbereider aanwezig te zijn in het betreffende gehalte d.m.v. een controleprogramma, waarbij met betrekking tot de fysieke controle rekening kan worden gehouden met de informatie van de PDV-databank ongewenste stoffen en producten of een eigen databank.

4.6.4. Hygiënisch werken [Vervallen per 01-01-2006]

Er dienen microbiologische criteria voor voedermiddelen vastgelegd te zijn, afhankelijk van het al dan niet ondergaan van een behandeling van voedermiddelen en/of diervoeder.

Wanneer mengvoeders worden geproduceerd waarbij geen behandeling om salmonella te reduceren wordt toegepast, dient de onder- nemer;

  • a. uitsluitend voedermiddelen aan te kopen en te ontvangen van leveranciers die een zodanig kwaliteitssysteem hebben dat de

    microbiologische kwaliteit van de voedermiddelen is gewaarborgd en/of;

  • b. inzicht te hebben in de microbiologische kwaliteit van voedermiddelen af te leiden uit bedrijfsinterne dan wel -externe databestanden en/of;

  • c. (kritische) voedermiddelen te bemonsteren en bij het constateren van salmonella actie te ondernemen. Voor deze actie dient een procedure te zijn vastgesteld.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

-

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Verwerking toevoeging- en diergeneesmiddelen [Vervallen per 01-01-2006]

Bij de verwerking van voormengsels in meng- voeders dient zodanig te worden gewerkt dat de juiste toevoeging- en diergeneesmiddelen, in de juiste dosering, uniform, met een acceptabel niveau van versleping, in het juiste mengvoeder worden verwerkt.

4.9.2. Installaties [Vervallen per 01-01-2006]

Installaties voor de bereiding van mengvoeders dienen zo te zijn ontworpen en te functioneren dat:

  • a. een uniforme verdeling van de bestand- delen in het mengsel wordt verkregen binnen de door het productschap vastgestelde criteria;

  • b. na de menger de bestanddelen uniform in het mengsel verdeeld blijven totdat het mengvoeder wordt afgeleverd;

  • c. onacceptabele versleping van toevoeging- en diergeneesmiddelen wordt voorkomen.

Indien in een installatie toevoegingmiddelen en diergeneesmiddelen worden verwerkt, dient bekend te zijn welke mate van versleping optreedt. Dit dient getoetst te zijn met behulp van een door het productschap vastgestelde toetsingsprocedure.

4.9.3. Opslag [Vervallen per 01-01-2006]

Voormengsels dienen zodanig opgeslagen te zijn dat zij gemakkelijk geïdentificeerd kunnen worden en verwarring met andere voormengsels, toevoegingmiddelen, diergeneesmiddelen, en/of diervoeders uitgesloten wordt, en de uiterste verwerkingsdatum goed nageleefd kan worden.

In de opslagruimte dient een apart deel aanwezig te zijn voor de opslag van voormengsels.

Ingeval gebruik wordt gemaakt van doseersilo's voor voormengsels, dient bij het vullen van deze silo's:

  • a. een adequaat vergrendelingsysteem te worden toegepast en;

  • b. een adequate innamenvolgorde van voormengsels te worden vastgelegd, indien gebruik wordt gemaakt van gemeenschappelijke transportwegen.

Hiervoor dient een procedure te zijn vastgelegd.

4.9.4. Toevoegen aan mengvoeder [Vervallen per 01-01-2006]

Afhankelijk van de mate van de versleping van de installatie, dient het verwerken van bepaalde toevoeging- en diergeneesmiddelen te worden aangepast (evt. niet gebruiken), zodanig dat nog wordt voldaan aan hetgeen voor de individuele middelen in de lijst met gekende toevoeging- en diergeneesmiddelen (GMP21) is aangegeven.

In de productspecificaties dient de dosering van de te onderscheiden voormengsels met toevoeging- dan wel diergeneesmiddelen te zijn vastgelegd.

Voormengsels dienen aan de hoofdstroom van het mengvoeder te worden toegevoegd, zo dicht mogelijk bij of in de menger, maar na de hamermolen/het maalproces.

Bij toevoeging van het voormengsel aan het diervoeder dient een zodanig systeem van vergrendeling of signalering toegepast te worden, dat gewaarborgd is dat het bedoelde voormengsel in het bestemde mengvoeder terechtkomt, alsmede in de juiste hoeveelheid. Hiervoor dient een procedure te zijn vastgelegd.

Het transport van voormengsels van oorspronkelijke verpakking dan wel opslagsilo

naar de weeg- en doseerapparatuur moet zodanig zijn dat de transportweg per voormengsel zoveel mogelijk is afgestemd op de te transporteren hoeveelheid.

4.9.5. Productievolgorde [Vervallen per 01-01-2006]

De productievolgorde van mengvoeders met voor-mengsels dient zodanig te zijn, dat wordt voldaan aan de normen zoals aangegeven in de lijst met gekende toevoeging- en diergeneesmiddelen (GMP21).

De productievolgorde dient vastgelegd te zijn in voorschriften zodanig dat bij het aanbieden van de mengvoederreceptuur aan de productie de productievolgorde in acht wordt genomen.

De gerealiseerde productievolgorde dient geadministreerd en gearchiveerd te worden.

4.9.6. Weegapparatuur [Vervallen per 01-01-2006]

De voormengsels dienen met daartoe geëigende weegapparatuur te worden gewogen. In alle gevallen moet de weegapparatuur makkelijk schoon te maken zijn.

De weegapparatuur dient wat betreft het weeg- vermogen afgestemd te zijn op de hoeveel- heden af te wegen product.

Van de weegapparatuur dient duidelijk te zijn aangegeven en vastgelegd:

  • a. de minimaal en maximaal toegelaten belasting van het weegapparaat;

  • b. de nauwkeurigheid van het weegapparaat.

Transport vanaf weegapparatuur naar menger: Er dient een zodanige beveiliging aangebracht te zijn, dat men er zeker van is dat al het afgewogen voormengsel inderdaad in het daar- voor bestemde diervoeder terecht is gekomen.

4.9.7. Eisen aan de menger [Vervallen per 01-01-2006]

Het mengen van voormengsel in mengvoeder dient zo te geschieden, dat een uniforme ver- deling van de betreffende toevoeging- dan wel diergeneesmiddelen wordt verkregen binnen de door het productschap vastgestelde criteria.

Zowel de vullingsgraad van de menger, als de mengtijd dienen tussen vastgelegde minimum en maximum (volume)waarden te liggen, die afhankelijk zijn van het type menger. De mengtijd gaat pas in nadat alle voedermiddelen inclusief voormengsels in de menger zijn gestort.

Voor het mengen van voormengsels in mengvoeders dient gebruik gemaakt te worden van mengapparaten die zo zijn geconstrueerd, dat versleping lager is dan het maximum acceptabel niveau.

Voor mengers dient er een onderhouds-, controle- of inspectieschema vastgelegd te zijn, waarin frequentie en aard van de controles zijn opgenomen, bijvoorbeeld controle op slijtage, aankoeken, hoeveelheid achtergebleven materiaal, enz.

4.9.8. Transportsystemen [Vervallen per 01-01-2006]

Transportsystemen voor meel dienen deugdelijk geaard te zijn om elektrostatische oplading van deeltjes te voorkomen.

Het gehele transportsysteem dient in verband met afzetting van product goed toegankelijk te zijn om te kunnen worden gereinigd. Er dient een protocol voor reiniging van het gehele transportsysteem vastgelegd en uitgevoerd te worden.

Voor transportsystemen dient er een inspectie- en onderhoudsschema vastgelegd te zijn, waar- in frequentie en aard van de inspectie- en onderhoudsbeurten vermeld en de bevindingen c.q. het verrichte onderhoud en de reparaties vastgelegd zijn.

4.9.9. Pelleteren [Vervallen per 01-01-2006]

Bij het pelleteren van mengvoeders dienen de condities afgestemd te worden op de stabiliteit van de verwerkte toevoeging- en diergeneesmiddelen, conform de verwerkingsadviezen zoals die door de leverancier van voormengsels zijn verstrekt. Deze condities dienen echter niet in strijd te zijn met de voorwaarden betreffende hygiënisch produceren.

4.9.10. Retourstromen [Vervallen per 01-01-2006]

Het omgaan met klopmeel afkomstig uit filters van pneumatische systemen van de installatie dient punt van aandacht te zijn voor de mengvoederbereider. Indien relevant dient een procedure te zijn vastgelegd op welke wijze hiermee omgegaan wordt om versleping van

toevoeging- en diergeneesmiddelen tegen te gaan.

De productie van mengvoeder dient zo te zijn ingericht dat retourstromen zoveel mogelijk worden beperkt. Het betreft hier zowel interne retourstromen (in de fabriek ontstaan), als externe retourstromen (retour geleverde mengvoeders).

(Interne) retourstromen dienen te worden terug- gevoerd in de charge of run waaruit ze afkomstig zijn. Als dit niet mogelijk is, dient vastgelegd te zijn in welke silo(cellen) (interne als ook externe) retourstromen van gekenmerkte diervoeders opgeslagen dienen te worden.

In een procedurevoorschrift dient vastgelegd te zijn welke retourproducten in welke voedersamenstellingen mogen worden opgenomen, alsmede in welk percentage zulks ten hoogste mag geschieden. Dit dient in ieder geval niet strijdig te zijn met de voorwaarden in de lijst met gekende toevoeging- en diergeneesmiddelen (GMP21).

Van externe retourstromen dient de kwaliteit bekend te zijn. Men dient zich er van te vergewissen of dat dan niet vermenging of kruiscontaminatie op het externe bedrijf heeft plaatsgevonden. Voor het terughalen van mengvoeders dient een procedure te zijn vastgelegd.

Uit de dagelijks bij te houden administratie dient afgeleid te kunnen worden welke hoeveelheden retourproduct is verwerkt en in welke partijen (per voedersoort) dat is geschiedt.

4.9.11. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Indien voedermiddelen worden verwerkt, die het gehalte aan ongewenste stoffen en producten zoals vermeld in Richtlijn 1999/29/EG inzake ongewenste stoffen en producten in diervoeding overschrijden, moet aantoonbaar zijn op welke wijze wordt geborgd dat de norm voor diervoeders in het te produceren mengvoeder niet wordt overschreden.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Ontvangst toevoeging- en diergeneesmiddelen [Vervallen per 01-01-2006]

De mengvoederbereider dient van de ontvangen partij voormengsel/toevoegingmiddel vastgelegd te hebben:

  • a. de naam van de fabrikant/leverancier;

  • b. de generieke naam van het toevoeging- of diergeneesmiddel in het voormengsel;

  • c. het charge- of referentienummer zoals toegekend door de fabrikant/leverancier;

  • d. het (de) door de fabrikant/leverancier gegarandeerde gemiddelde gehalte(n) van de werkzame stof(fen) in het voormengsel;

  • e. de (aanvullende) gebruiksaanwijzingen;

  • f. datum van ontvangst;

  • g. houdbaarheidstermijn.

4.10.2. Hygiëne inspecties [Vervallen per 01-01-2006]

De ondernemer dient periodiek controles door middel van microbiologisch onderzoek dan wel onderzoek naar parameters omtrent de microbiologische kwaliteit uit te voeren in de voedermiddelen (bij ontvangst of aankoop) en mengvoeders volgens een door hem zelf vastgestelde frequentie, die tenminste in overeenstemming zijn met de in de GMP- regeling vastgestelde minimum frequentie.

Indien het diervoeder geen salmonella reducerende behandeling in het productieproces ondergaat, dient het controleprogramma zodanig te zijn, dat de ondernemer inzicht heeft in de microbiologische kwaliteit van de voedermiddelen, en dat aantoonbaar de bedrijfshygiëne beheerst en de hygiënedoelstelling gerealiseerd wordt.

4.10.3. Kwaliteitscontroles [Vervallen per 01-01-2006]

De ondernemer draagt zorg dat van iedere partij of, in geval van continu-productie, van elk bepaald productiegedeelte voldoende monsters worden genomen, die, met het oog op traceerbaarheid moeten worden bewaard.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

4.13.1. Hygiënisch werken [Vervallen per 01-01-2006]

Als een partij voedermiddelen niet voldoet aan de door de ondernemer gestelde microbiologische criteria, dan wordt deze partij uitsluitend in het bedrijf tot diervoeder verwerkt indien het realiseren van de doelstelling van de GMP-regeling door zonodig aangepaste behandeling haalbaar blijft. Hiervoor dient een bedrijfsinterne procedure opgesteld te zijn.

Wanneer adequate behandeling niet mogelijk is dient de betreffende partij voedermiddelen in een door het productschap gecertificeerd decontaminatiebedrijf gedecontamineerd te worden.

Opslagruimten waarin zich besmette partijen hebben bevonden dienen zodanig gereinigd te worden dat geen herbesmetting van volgende partijen kan plaatsvinden. Hiervoor dient een procedure vastgelegd te zijn, alsmede dienen het aanwezig zijn van besmette ruimten en de reiniging daarvan te worden geregistreerd.

Indien een thermische behandeling wordt ingezet om de hygiëne te beheersen dient bij een overschrijding van de actiegrens door het bedrijf actie te worden ondernomen om de oorzaak op te sporen en te werken aan bijstelling van het productieproces.

4.13.2. Andere behandeling [Vervallen per 01-01-2006]

Bij een andere behandeling dan een thermische, dient bij het constateren van salmonella in eindproduct dient door het bedrijf actie te worden ondernomen om de oorzaak op te sporen en te werken aan bijstelling van het productieproces.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

4.14.1. Hygiënisch werken [Vervallen per 01-01-2006]

Bij het constateren van salmonella in voedermiddelen of eindproduct dient door het bedrijf actie te worden ondernomen om de oorzaak op te sporen. Op grond hiervan dienen voorts maatregelen te worden genomen. De genomen actie dient t.b.v. verificatie te worden vastgelegd.

Als de microbiologische kwaliteit van een voedermiddel niet voldoet aan de door het bedrijf dan wel in deze standaard hieraan gestelde beoordelingscriteria, dient de oorzaak te worden opgespoord en dient actie te worden ondernomen om de oorzaak weg te nemen. Hiervoor dient een procedure te zijn vastgelegd. Van de actie dient zodanig aantekening en archivering plaats te vinden dat verificatie achteraf mogelijk is.

Indien een thermische behandeling wordt toegepast en het aantal Enterobacteriaceae van diervoeder per 1 gram meer is dan 1000 dient duidelijk te zijn welke actie door de ondernemer is genomen om de oorzaak hiervan op te sporen en welke actie is genomen om bedrijfsinrichting dan wel bedrijfsvoering aan te passen.

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

4.15.1. Toevoegings- en diergeneesmiddelen [Vervallen per 01-01-2006]

De productinformatie en -begeleiding dient hierbij zodanig te zijn dat het volgende in acht genomen kan worden door de veehouder:

  • a. eventuele wachttermijnen;

  • b. de toedieningsvoorschriften aan de dieren;

  • c. specifieke opslag- en gebruikscondities voortvloeiend uit de eigenschappen van de verwerkte toevoeging- of diergeneesmiddelen.

Mengvoeders waarvan de houdbaarheidstermijn reeds voor een belangrijk deel is verstreken, dienen slechts afgeleverd te worden indien, al dan niet na overleg met de betreffende afnemer, de zekerheid bestaat dat het mengvoeder voor het verstrijken van de houdbaarheidstermijn wordt vervoederd.

4.15.2. Hygiënisch werken [Vervallen per 01-01-2006]

4.15.2.1. Thermische behandeling [Vervallen per 01-01-2006]

Na de thermische behandeling tot het moment van aflevering van diervoeder dient geen herbesmetting (met salmonella) op te treden. In het bijzonder dient koeling, transport en opslag van gereed product en aflevering te worden beheerst.

4.15.2.2. Andere behandeling [Vervallen per 01-01-2006]

Na deze behandeling tot het moment van aflevering van diervoeder dient geen herbesmetting (met salmonella) op te treden. In het bijzonder dient koeling, opslag en transport van gereed product en aflevering te worden beheerst.

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

4.19.1. Toevoegings- en diergeneesmiddelen [Vervallen per 01-01-2006]

De veehouder is zelf verantwoordelijk op welke wijze opslag en vervoedering op het veehouderijbedrijf plaatsvindt.

4.19.2. Hygiënisch werken [Vervallen per 01-01-2006]

De veehouder is zelf verantwoordelijk voor het handhaven van de hygiënische kwaliteit van het voer op het veehouderijbedrijf na aflevering van het voer. Ten behoeve hiervan wordt aan de veehouder een zodanige productinformatie en begeleiding gegeven dat de veehouder de hygiënische kwaliteit van het diervoeder kan handhaven. In het bijzonder wordt aandacht gegeven aan de opslagvoorzieningen en -condities.

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

03. GMP-standaard handel en productie voormengsels GMP03; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijk

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

  4.3.1 Toevoegings- en diergeneesmiddelen 3
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

3

  4.6.1 Volledige voormengsels 3
  4.6.2 Grond- en hulpstoffen uit de agro-industrie, toevoegingsmiddelen specifiek bedoeld voor diervoeder 3
  4.6.3 Aankoop van producten uit niet-agro-sectoren 4
  4.6.4 Actualisatie 4
  4.6.5 Op- en overslag 4
 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

4

  4.9.1 Toevoegings- en diergeneesmiddelen 4
 

4.10

Keuring en Beproeving

6

  4.10.1 Ontvangst toevoeging- en diergeneesmiddelen 6
  4.10.2 Kwaliteitscontroles voormengsels 6
 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

6

 

4.12

Keurings- en Beproevingsstatus

6

 

4.13

Beheersing van Producten met Afwijkingen

7

 

4.14

Corrigerende en preventieve Maatregelen

7

 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

7

 

4.16

Beheersing van Kwaliteitsregistraties

7

 

4.17

Interne Kwaliteitaudits

7

 

4.18

Opleiding

7

 

4.19

Nazorg

7

 

4.20

Statistische Technieken

7

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling voor producenten van en handelaren in voormengsels op de algemene GMP-standaard diervoedersector (GMP01). De algemene GMP- standaard diervoedersector (GMP01) is integraal ook van toepassing.

Indien de ondernemer verrichtingen uitvoert waarvoor een andere aanvullende GMP- standaard bestaat (b.v. voor op- en overslag, transport, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

Voor de definities van o.a. voormengsels en toevoegingsmiddelen wordt verwezen naar de diervoederwetgeving, met name EU-richtlijn 70/524 en EU-richtlijn 82/471

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

4.3.1. Toevoeging- en diergeneesmiddelen [Vervallen per 01-01-2006]

De ondernemer heeft het maximaal aanvaardbare verschil tussen gedeclareerd en geanalyseerd gehalte van toevoeging- en diergeneesmiddelen vastgelegd. Deze dienen minimaal aan de wettelijk vastgestelde toleranties te voldoen.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Volledige voormengsels [Vervallen per 01-01-2006]

Indien voormengsels niet zelf worden geproduceerd, dienen deze betrokken te worden bij GMP03-gecertificeerde bedrijven.

4.6.2. Grond- en hulpstoffen uit de agro-industrie, toevoegingsmiddelen specifiek bedoeld voor diervoeder [Vervallen per 01-01-2006]

Onder staande bepalingen gelden voor de aankoop van

  • grond- en hulpstoffen uit de agro- industrie, die de ondernemer gebruikt voor de productie van voormengsels,

  • toevoegingsmiddelen die specifiek bedoeld zijn voor gebruik in diervoeder

De ondernemer koopt de hiervoor genoemde producten uitsluitend van leveranciers die gecertificeerd zijn, waarbij aantoonbaar op het moment van levering minimaal aan het volgende wordt voldaan:

  • 1. De leverancier is GMP04/05-gecertificeerd (bij levering van grond- en hulpstoffen uit de agro-industrie) resp. GMP09-gecertificeerd (bij levering van toevoegingsmiddelen).

  • 2. De leverancier van de grond- en hulpstoffen, zijnde een akkerbouwer, is een GMP-gecertificeerde teler ingevolge de GMP-standaard teelt van voedermiddelen (GMP11), of volgens een daarmee door het productschap uitwisselbaar verklaarde kwaliteitsstandaard.

  • 3. Indien de ondernemer de grond- en hulpstoffen van een leverancier in het buitenland afneemt die niet aan het voorgaande voldoet, dient de ondernemer te voldoen aan de aanvullende voorwaarden voor de GMP-standaard voor de handelaren van voedermiddelen GMP05).

4.6.3. Aankoop van producten uit niet-agro- sectoren7 [Vervallen per 01-01-2006]

Onder staande bepalingen gelden voor de aankoop van

  • grond- en hulpstoffen uit andere dan de agro-industrie, die de ondernemer gebruikt voor de productie van voormengsels.

  • toevoegingsmiddelen die niet specifiek bedoeld zijn voor gebruik in diervoeder

Voorafgaand aan de aankoop voert de ondernemer zelf een op HACCP-principes gebaseerde risicobeoordeling van de bedoelde producten uit. Op basis van deze risicobeoordeling én de kwaliteitsborging, die de leverancier van het product toepast, maakt de ondernemer een leveranciersselectie en stemt hij zijn ingangscontrole daarop af.

4.6.4. Actualisatie [Vervallen per 01-01-2006]

Indien de normen voor grond- en hulpstoffen ingevolge de GMP-regeling wijzigen, gelden deze voor alle nieuwe aankopen op het moment van de inwerkingtreding ervan. Voor lopende contracten geldt (met uitzondering van de wettelijke eisen) een uitzondering, onder voorwaarde dat deze ten genoegen van het productschap en onverwijld en ten allen tijde kunnen worden getoond en waarbij de maximale looptijd van 8 maanden niet wordt overschreden.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

-

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Verwerking toevoeging- en diergeneesmiddelen [Vervallen per 01-01-2006]

Bij de verwerking van toevoeging- en diergeneesmiddelen in voormengsels dient zodanig te worden gewerkt dat de juiste toevoeging- en diergeneesmiddelen, in de juiste dosering, uniform, met een acceptabel niveau van versleping, in het juiste voormengsel worden verwerkt.

4.9.2. Installaties [Vervallen per 01-01-2006]

Installaties voor de bereiding van voormengsels dienen zo te zijn ontworpen en te functioneren dat:

  • a. een uniforme verdeling van de bestanddelen in het mengsel wordt verkregen binnen de door het productschap vastgestelde criteria;

  • b. na de menger de bestanddelen uniform in het mengsel verdeeld blijven totdat het voormengsel wordt afgeleverd;

  • c. onacceptabele versleping van toevoeging- en diergeneesmiddelen wordt voorkomen.

Indien in een installatie toevoegingmiddelen en diergeneesmiddelen worden verwerkt dient bekend te zijn welke mate van versleping optreedt. Dit dient getoetst te zijn met behulp van een door het productschap vastgestelde toetsingsprocedure.

4.9.3. Opslag [Vervallen per 01-01-2006]

Voormengsels dienen zodanig opgeslagen te zijn dat zij gemakkelijk geïdentificeerd kunnen worden en verwarring met andere voormengsels, toevoegingsmiddelen, diergeneesmiddelen, en/of diervoeders uitgesloten wordt en de tijdige aflevering i.v.m. de uiterste verwerkingsdatum gerealiseerd kan worden.

In de opslagruimte dient een apart deel aanwezig te zijn voor de opslag van toevoeging- en diergeneesmiddelen.

Producten die niet in eigen locatie worden op- en overgeslagen, zijn op- en overgeslagen bij GMP-gecertificeerde op- en overslagbedrijven.

Indien op- en overslag niet in een GMP- gecertificeerde bedrijfseenheid plaatsvindt, dient de ondernemer zelf maatregelen vast te leggen en uit te voeren, die gelijkwaardige waarborgen omtrent de kwaliteit van voedermiddelen jegens zijn afnemers bieden.

4.9.4. Toevoegen aan voormengsel [Vervallen per 01-01-2006]

Afhankelijk van de mate van de versleping van de installatie dient het verwerken van toevoeging- en diergeneesmiddelen te worden aangepast (evt. niet gebruiken), zodanig dat nog wordt voldaan aan hetgeen voor de individuele middelen in de lijst met gekende toevoeging- en diergeneesmiddelen is aangegeven.

In de productspecificaties dient de dosering van de te onderscheiden toevoeging- dan wel dier- geneesmiddelen te zijn vastgelegd.

Het transport van toevoeging- en diergeneesmiddelen van oorspronkelijke verpakking of op- slagsilo naar de weeg- en doseerapparatuur moet plaatsvinden met geëigende transportmiddelen. Ingeval gebruik wordt gemaakt van doseersilo's voor toe-voegingmiddelen, dient bij het vullen van deze silo's;

  • -

    een adequaat doseer- en vergrendelingssysteem te worden toegepast en;

  • -

    een transportvolgorde van toevoeging- en/of diergeneesmiddelen te worden vast- gelegd, indien gebruik wordt gemaakt van gemeenschappelijke transportwegen.

Hiervoor dient een procedure te zijn vastgelegd.

Bij toevoeging van het toevoeging- en diergeneesmiddelen aan het voormengsel dient een zodanig systeem van vergrendeling of signalering toegepast te worden, dat gewaarborgd is dat het bedoelde toevoeging- of diergeneesmiddel in het bestemde voormengsel terechtkomt, alsmede in de juiste hoeveelheid. Hiervoor dient een procedure te zijn vastgelegd.

4.9.5. Productievolgorde [Vervallen per 01-01-2006]

De productievolgorde van voormengsels dient zodanig te zijn dat wordt voldaan aan de nor- men zoals aangegeven in de lijst met gekende toevoeging- en diergeneesmiddelen.

De productievolgorde dient vastgelegd te zijn in voorschriften zodanig dat bij het aanbieden van de receptuur aan de productie de productievolgorde in acht wordt genomen.

De gerealiseerde productievolgorde dient geadministreerd en gearchiveerd te worden.

4.9.6. Weegapparatuur [Vervallen per 01-01-2006]

De toevoeging- en diergeneesmiddelen dienen met daartoe geëigende weegapparatuur te worden gewogen. In alle gevallen moet de weegapparatuur makkelijk schoon te maken zijn.

De weegapparatuur dient wat betreft het weegvermogen afgestemd te zijn op de hoeveelheden af te wegen product.

Van de weegapparatuur dient duidelijk te zijn aangegeven en vastgelegd:

  • a. de minimaal en maximaal toegelaten belasting van het weegapparaat;

  • b. de nauwkeurigheid van het weegapparaat;

Transport vanaf weegapparatuur naar menger: Er dient een zodanige beveiliging aangebracht te zijn, dat men er zeker van is dat al de afgewogen toevoeging- en/of diergeneesmiddelen inderdaad in het daarvoor bestemde voormengsel terecht is gekomen.

4.9.7. Eisen aan de menger [Vervallen per 01-01-2006]

Het mengen van toevoeging- en diergeneesmiddelen in een voormengsel dient zo te geschieden, dat een uniforme verdeling van de betreffende toevoeging- dan wel diergeneesmiddelen wordt verkregen binnen de door het productschap vastgestelde criteria.

Zowel de vullingsgraad van de menger, als de mengtijd dienen tussen vastgelegde minimum en maximum (volume)waarden te liggen, die afhankelijk zijn van het type menger. De mengtijd gaat pas in nadat alle voedermiddelen inclusief de toevoeging- en/of diergeneesmiddelen in de menger zijn gestort.

Voor het bereiden van voormengsels dient gebruik gemaakt te worden van mengapparaten die zo zijn geconstrueerd dat versleping lager is dan het maximum acceptabel niveau.

Voor mengers dient er een onderhoud-, controle- of inspectieschema vastgelegd te zijn, waarin frequentie en aard van de controles zijn vastgelegd, bijvoorbeeld controle op slijtage, aankoeken, hoeveelheid achtergebleven materiaal, enz.

4.9.8. Transportsystemen [Vervallen per 01-01-2006]

Transportsystemen voor meel dienen deugdelijk te zijn geaard om elektrostatische oplading van deeltjes te voorkomen.

Het gehele transportsysteem dient in verband met afzetting van product goed toegankelijk te zijn om te kunnen worden gereinigd. Er dient een protocol voor reiniging van het gehele transportsysteem te worden vastgelegd en uitgevoerd.

Voor transportsystemen dient er een vastgelegd inspectie- en onderhoudsschema te zijn waarin frequentie en aard van de inspectie- en onderhoudsbeurten zijn vermeld en de bevindingen c.q. het verrichte onderhoud en de reparaties zijn vastgelegd.

4.9.9. Retourstromen [Vervallen per 01-01-2006]

Het omgaan met klopmeel afkomstig uit filters van pneumatische systemen van de installatie dient punt van aandacht te zijn. Indien mogelijk dient een procedure te zijn vastgelegd op welke wijze hiermee omgegaan wordt om versleping van toevoeging- en diergeneesmiddelen tegen te gaan.

De productie van voormengsel dient zo te zijn ingericht dat retourstromen zoveel mogelijk worden beperkt. Het betreft hier zowel interne retourstromen (binnen de installatie ontstaan), als externe retourstromen (retour geleverde voormengsels).

(Interne) retourstromen dienen te worden teruggevoerd in de charge of run waaruit ze afkomstig zijn. Als hetgeen genoemd dit niet mogelijk is, dient vastgelegd te zijn in welke silo(cellen) (interne als ook externe) retourstromen van gekenmerkte voormengsels opgeslagen dienen te worden.

In een procedurevoorschrift dient vastgelegd te zijn welke retourproducten in welke voormengselsamenstellingen mogen worden opgenomen, alsmede in welk percentage zulks ten hoogste mag geschieden. Dit dient in ieder geval niet strijdig te zijn met de voorwaarden in de lijst met gekende toevoeging- en diergeneesmiddelen.

Retourstromen mogen alleen in voormengsels voor doeldieren worden toegevoegd.

Van externe retourstromen dient de kwaliteit bekend te zijn. Men dient zich er van te vergewissen of al dan niet vermenging of kruiscontaminatie op het externe bedrijf heeft plaatsgevonden. Voor het terughalen van voormengsels dient een procedure te zijn vastgelegd.

Uit de dagelijks bij te houden administratie dient afgeleid te kunnen worden welke hoeveelheden retourproduct is verwerkt, en in welke partijen (per voormengselsoort) dat is geschiedt.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Ontvangst toevoeging- en diergeneesmiddelen [Vervallen per 01-01-2006]

De voormengselbereider dient van de ontvangen partij toevoeging- en/of diergeneesmiddel vastgelegd te hebben:

  • a. de naam van de fabrikant/leverancier;

  • b. de generieke naam van het toevoeging- of diergeneesmiddel;

  • c. het charge- of referentienummer zoals toegekend door de fabrikant/leverancier;

  • d. het (de) door de fabrikant/leverancier gegarandeerde gemiddelde gehalte(n) van de werkzame stof(fen) in het toevoeging-/dier- geneesmiddel;

  • e. de (aanvullende) gebruiksaanwijzingen;

  • f. datum van ontvangst;

  • g. houdbaarheidstermijn.

Bij de ontvangst van toevoeging- en diergeneesmiddelen dient iedere verpakkingseenheid te worden gecontroleerd op beschadigingen en op de juiste wijze aangebrachte aanduidingen op het etiket of het begeleidend document.

Het gestelde in de voorgaande alinea's geldt voor de handelaar voor de te ontvangen voormengsels.

4.10.2. Kwaliteitscontroles voormengsels [Vervallen per 01-01-2006]

De ondernemer draagt zorg dat van iedere partij of, in geval van continu-productie, van elk bepaald productiegedeelte voldoende monsters worden genomen, die, met het oog op traceerbaarheid moeten worden bewaard.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

-

4.14. Coorigerende en preventieve maatregelen [Vervallen per 01-01-2006]

-

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

De productinformatie en -begeleiding dient zodanig te zijn, dat de mengvoederbereider goed in staat is om bij haar afnemers/veehouders te bewerkstelligen dat veehouders het volgende in acht kunnen nemen:

  • a. eventuele wachttermijnen;

  • b. de toedieningsvoorschriften aan de dieren;

  • c. specifieke opslag- en gebruikscondities voortvloeiend uit de eigenschappen van de verwerkte toevoeging- of diergeneesmiddelen.

De geleverde kwaliteit voldoet aan de door de mengvoederbereider gehanteerde en met de voormengselbereider afgesproken normspecificatie.

Gegevens met betrekking tot veilig werken met de voormengsels en (aanvullende) gebruiksaanwijzingen worden expliciet al dan niet (verplicht) op het etiket aangegeven.

De voor vermelding relevante bepalingen die bij registratie en/of in de lijst met gekende toevoeging- en diergeneesmiddelen van de toevoeging- en diergeneesmiddelen zijn aangegeven dienen expliciet al dan niet op het etiket te zijn aangegeven.

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

-

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

04. GMP-standaard productie voedermiddelen GMP04; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijk

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

  4.3.1 Ongewenste stoffen en producten 3
  4.3.2 Hygiënisch werken 3
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

4

  4.6.1 Algemeen 4
  4.6.2 Ongewenste stoffen en producten 4
  4.6.3 Hygiënisch werken 4
 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

4

  4.9.1 Opslag 4
  4.9.2 Handel 6
  4.9.3 Productie 6
 

4.10

Keuring en Beproeving

6

  4.10.1 Hygiënisch werken 6
 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

6

 

4.12

Keurings- en Beproevingsstatus

6

 

4.13

Beheersing van Producten met Afwijkingen

6

  4.13.1 Algemeen 6
  4.13.2 Andere behandeling 6
 

4.14

Corrigerende en preventieve Maatregelen

7

  4.14.1 Hygiënisch werken 7
 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

7

 

4.16

Beheersing van Kwaliteitsregistraties

7

 

4.17

Interne Kwaliteitsaudits

7

 

4.18

Opleiding

7

 

4.19

Nazorg

7

 

4.20

Statistische Technieken

7

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling voor producenten van voedermiddelen op de algemene GMP-standaard diervoedersector (GMP01). De algemene GMP-standaard diervoedersector (GMP01) is integraal ook van toepassing.

Het gaat om voedermiddelen bestemd voor aflevering aan:

  • handelaren in en producenten van voedermiddelen of

  • veehouderijbedrijven of

  • mengvoederproducenten, of

  • voormengselproducenten of

  • toevoegingsmiddelenproducenten

Indien de ondernemer verrichtingen uitvoert waarvoor een aanvullende GMP-standaard bestaat (b.v. voor op- en overslag, transport, of handel of productie mengvoeders), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

N.B. Tot februari 2003 was er een speciale GMP-standaard Voedervetten. Met ingang van februari is deze speciale GMP-standaard Voedervetten komen te vervallen en zijn de voorwaarden uit GMP04 resp. GMPO ook van toepassing op producenten en handelaren van voedervetten. Dit betekent niet dat voedervetten niet meer als een kritische grondstof beschouwd wordt. Nieuwe wetgeving (o.a Verordening 1774/2002) en aanscherpte GMP- standaarden GMP04 en GMP05 bevatten echter inmiddels voldoende waarborgen voor een adequate borging van kwaliteit en veiligheid van voedervetten, zodat een aparte GMP- standaard Voedervetten niet meer nodig is. De tekst van de 'oude' GMP-standaard Voedervetten bevat echter nog veel waarde- volle (achtergrond)informatie en specifieke verduidelijkingen met betrekking tot voeder- vetten en is daarom als zodanig opgenomen in GMP28.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

4.3.1. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Voedermiddelen dienen in principe niet met elkaar vermengd te geraken. Voor die gevallen waarin vermenging toch plaatsvindt, dient te zijn vastgelegd in welke mate voedermiddelen met elkaar vermengd mogen geraken.

4.3.2. Hygiënisch werken [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem wordt gehanteerd, dat aantoonbaar wordt voldaan aan de wettelijke eisen en de normen in de GMP-regeling en dat de handeling van diervoeders op hygiënische wijze plaatsvindt, waardoor de microbiologische kwaliteit wordt beheerst.

De hygiëne paragrafen in deze GMP-standaard hebben betrekking op alle geproduceerde en/of verhandelde voedermiddelen.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer koopt uitsluitend voedermiddelen van leveranciers, waarbij aantoonbaar op het moment van levering minimaal aan het volgende wordt voldaan:

  • 1. De leverancier is een GMP-gecertificeerde handelaar of producent van voedermiddelen 8(GMP04/GMP05). De leverancier, zijnde een akkerbouwer, is een GMP- gecertificeerde teler ingevolge de GMP- standaard teelt van voedermiddelen (GMP11), of volgens een daarmee door het productschap uitwisselbaar verklaarde kwaliteits-standaard9.

Indien de ondernemer voedermiddelen van een leverancier in het buitenland afneemt die niet aan het voorgaande voldoet, dient de leverancier gecertificeerd te zijn volgens GMP13.

Het productschap is gerechtigd de namen van de leveranciers, die voldoen aan de GMP- voorwaarden als hiervoor bedoeld, te publiceren.

Indien de normen voor voedermiddelen ingevolge de GMP-regeling wijzigen, gelden deze voor alle nieuwe aankopen op het moment van de inwerkingtreding ervan. Voor lopende contracten geldt (m.u.v. wettelijke eisen) een uitzondering onder voorwaarde dat deze ten genoegen van het productschap en onverwijld en te allen tijde kunnen worden getoond en waarbij de maximale looptijd van 8 maanden niet wordt overschreden.

Indien de ondernemer mengsels van voedermiddelen aflevert, maar deze niet zelf produceert, dienen deze uitsluitend betrokken en/of geproduceerd te zijn bij een GMP- gecertificeerd bedrijf (volgens GMP02).

4.6.2. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Er dienen uitsluitend voedermiddelen betrokken te worden van toeleveranciers die waarborgen dat voedermiddelen worden geleverd, die geen hoger gehalte aan contaminanten bevatten dan de door het bedrijf (o.b.v. de risicobeoordeling) vastgestelde normen. De vastgestelde normen moeten minimaal voldoen aan de normen voor ongewenste stoffen en producten in voedermiddelen zoals opgenomen in de diervoederwetgeving en de in het kader van deze GMP-regeling vastgestelde normen (GMP14).

4.6.3. Hygiënisch werken [Vervallen per 01-01-2006]

Er dienen microbiologische criteria voor voedermiddelen te zijn vastgelegd, afhankelijk van het al dan niet ondergaan van een behandeling van voedermiddelen.

Wanneer geen behandeling wordt toegepast, dient de ondernemer voorts:

  • -

    uitsluitend voedermiddelen dan wel dier- voeders aan te kopen en te ontvangen van - leveranciers die een zodanig kwaliteitssysteem hebben dat de microbiologische kwaliteit van de voedermiddelen is gewaarborgd en/of;

  • -

    inzicht te hebben van de microbiologische kwaliteit van voedermiddelen af te leiden van bedrijfsinterne dan wel -externe databestanden en/of;

  • -

    (kritische) voedermiddelen te bemonsteren te analyseren en bij het constateren van salmonella actie te ondernemen. Voor deze actie dient een procedure te zijn vastgesteld.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

-

4.9. Procesbeheersing [Vervallen per 01-01-2006]

-

4.9.1. Opslag [Vervallen per 01-01-2006]

Op- en overslag dient plaats te vinden in een GMP-gecertificeerde bedrijfseenheid.

Indien op- en overslag bij een buitenlandse bedrijfseenheid plaatsvindt die niet aan het voorgaande voldoet, dan dient de ondernemer gecertificeerd te zijn volgens GMP06/GMP13.

Indien dit niet het geval is, dient de ondernemer zelf maatregelen vast te leggen en uit te voeren, die gelijkwaardige waarborgen omtrent de kwaliteit van voedermiddelen jegens zijn afnemers bieden.

4.9.2. Productie [Vervallen per 01-01-2006]

Er dienen geen voedermiddelen tot diervoeder te worden bestemd die voorkomen op de lijst van verboden voedermiddelen of anderszins bij of krachtens de GMP-regeling voor verwerking in diervoeders zijn uitgesloten.

De hulpstoffen en reinigingsmiddelen dienen geïnventariseerd te worden en beoordeeld op hun gevolgen voor de veiligheid voor mens, dier en milieu.

Ingeval van productie dient er een procedure aanwezig te zijn voor de reiniging van opslagruimten en de vrijgave voor het opnieuw hierin opslaan van voedermiddelen.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Hygiënisch werken [Vervallen per 01-01-2006]

De ondernemer dient periodiek controles door middel van microbiologisch onderzoek of onderzoek naar parameters omtrent de microbiologische kwaliteit uit te voeren in de voedermiddelen (bij ontvangst of aankoop) volgens een door hem zelf vastgestelde frequentie, die tenminste in overeenstemming zijn met de krachtens de GMP-regeling diervoedersector vastgestelde minimum frequentie.

De controlefrequentie is afhankelijk van de aard van de producten en het productieproces, de omvang van de productie en van de resultaten van de inspecties en controles.

Indien het diervoeder geen salmonella reducerende behandeling in het productieproces ondergaat, dient het controleprogramma zodanig te zijn, dat de ondernemer inzicht heeft in de microbiologische kwaliteit van de voeder- middelen, en dat aantoonbaar de bedrijfshygiëne beheerst en de hygiënedoelstelling gerealiseerd wordt.

4.11. Beheering van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

4.13.1. Algemeen [Vervallen per 01-01-2006]

Als een partij voedermiddelen niet voldoet aan de door de ondernemer gestelde microbiologische criteria, dan wordt deze partij uitsluitend in het bedrijf tot diervoeder bestemd, indien het realiseren van de doelstelling van de GMP-regeling door zonodig aangepaste behandeling haalbaar blijft. Hiervoor dient een bedrijfsinterne procedure opgesteld te zijn.

Het productschap kan hiervoor bij besluit richtlijnen voorschrijven.

Wanneer adequate behandeling niet mogelijk is dient de betreffende partij voedermiddelen in een door het productschap gecertificeerd decontaminatiebedrijf gedecontamineerd te worden.

Opslagruimten waarin zich besmette partijen hebben bevonden dienen zodanig gereinigd te worden dat geen herbesmetting van volgende partijen kan plaatsvinden. Hiervoor dient een procedure vastgelegd te zijn, alsmede dienen het aanwezig zijn van besmette ruimten en de reiniging daarvan te worden geregistreerd.

4.13.2. Andere behandeling [Vervallen per 01-01-2006]

Bij het constateren van salmonella in voedermiddelen of eindproduct dient door het bedrijf actie te worden ondernomen om de oorzaak op te sporen.

Op grond hiervan dienen voorts maatregelen te worden genomen m.b.t. terugdringen van salmonella besmetting en dient eventueel het aankoopbeleid bijgesteld te worden. De genomen actie dient t.b.v. verificatie te worden vastgelegd.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

4.14.1. Hygiënisch werken [Vervallen per 01-01-2006]

Ingeval salmonella wordt waargenomen dient duidelijk te zijn welke actie door het bedrijf is genomen om de oorzaak op te sporen en welke actie is ondernomen om de bedrijfsinrichting dan wel bedrijfsvoering aan te passen.

Van deze actie dient zodanig aantekening en archivering plaats te vinden dat verificatie achteraf mogelijk is.

Als de microbiologische kwaliteit van een voedermiddel niet voldoet aan de door het bedrijf dan wel in de GMP-regeling hieraan gestelde beoordelingscriteria, dient de oorzaak te worden opgespoord en dient actie te worden ondernomen om de oorzaak weg te nemen. Hiervoor dient een procedure te zijn vastgelegd. Van de actie dient zodanig aantekening en archivering plaats te vinden dat verificatie achteraf mogelijk is.

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

Na een behandeling van voedermiddel tot aflevering dient geen herbesmetting (met salmonella) op te treden.

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

Opslag door de afnemer: Aangegeven dient te worden op welke wijze de afnemer de geleverde producten dient op te slaan zodat bederf, microbiologische besmetting e.d. wordt voorkomen.

Aangegeven dient te worden wat de houdbaarheidstermijn is onder de te onderscheiden opslagcondities bij de afnemer.

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

05. GMP-standaard handel voedermiddelen GMP05; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied

FOUT! BLADWIJZER NIET GEDEFINIEERD.

2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

  4.3.1 Ongewenste stoffen en producten 3
  4.3.2 Hygiënisch werken 3
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

4

 

4.6

Inkoop

4

  4.6.1 Algemeen 4
  4.6.2 Ongewenste stoffen en producten 4
  4.6.3 Hygiënisch werken 4
 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

4

  4.9.1 Opslag 5
  4.9.2 Handel 5
 

4.10

Keuring en Beproeving

5

  4.10.1 Hygiënisch werken 5
 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

5

 

4.12

Keurings- en Beproevingsstatus

5

 

4.13

Beheersing van Producten met Afwijkingen

5

  4.13.1 Algemeen 5
  4.13.2 Andere behandeling 5
 

4.14

Corrigerende en preventieve Maatregelen

5

  4.14.1 Hygiënisch werken 5
 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

6

 

4.16

Beheersing van Kwaliteitsregistraties

6

 

4.17

Interne Kwaliteitsaudits

6

 

4.18

Opleiding

6

 

4.19

Nazorg

6

 

4.20

Statistische Technieken

6

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling voor handelaren in voedermiddelen op de al- gemene GMP-standaard diervoedersector (GMP01) De algemene GMP-standaard diervoedersector (GMP01) is integraal ook van toe- passing.

Het gaat om voedermiddelen bestemd voor aflevering aan:

  • handelaren en producenten van voedermiddelen of

  • veehouderijbedrijven of

  • mengvoederproducenten, of

  • voormengselproducenten of

  • toevoegingsmiddelen producenten

Indien de ondernemer verrichtingen uitvoert waarvoor een aanvullende GMP-standaard bestaat (b.v. voor op- en overslag, transport, of handel of productie mengvoeders), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

N.B. Tot februari 2003 was er een speciale GMP-code Voedervetten. Met ingang van februari is deze speciale GMP-code Voedervetten komen te vervallen en zijn de voorwaarden uit GMP04 resp.GMP05 ook van toepassing op producenten en handelaren van voedervetten. Dit betekent niet dat voedervetten niet meer als een kritische grondstof beschouwd wordt. Nieuwe wetgeving (o.a Verordening 1774/2002) en aanscherpte GMP-codes GMP04 en GMP05 bevatten echter inmiddels voldoende waarborgen voor een adequate borging van kwaliteit en veiligheid van voedervetten, zodat een aparte GMP-code Voedervetten niet meer nodig is. De tekst van de 'oude' GMP-code Voedervetten bevat echter nog veel waardevolle (achtergrondinformatie en specifieke verduidelijkingen met betrekking tot voedervetten en is daarom als zodanig opgenomen in GMP28.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

Het is de leverancier van voedermiddelen toegestaan om voedermiddelen in het verkeer te brengen waarop de GMP-regeling niet van toepassing is, mits hij beschikt over schriftelijke procedures om te waarborgen dat aan GMP- gecertificeerde ondernemers uitsluitend volgens GMP04/GMP05/GMP13 geborgde voedermiddelen worden geleverd. Dit is alleen van toepassing op leveranciers die alleen handel in voedermiddelen plegen, zonder andere activiteiten m.b.t. be- en verwerking, productie en op- en overslag

4.3. Normen [Vervallen per 01-01-2006]

4.3.1. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Voedermiddelen dienen in principe niet met elkaar vermengd te geraken. Voor die gevallen waarin vermenging toch plaatsvindt, dient te zijn vastgelegd in welke mate voedermiddelen met elkaar vermengd mogen geraken.

4.3.2. Hygiënisch werken [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem wordt gehanteerd, dat aantoonbaar wordt voldaan aan de wettelijke eisen en de normen in de GMP-regeling en dat de handeling van diervoeders op hygiënische wijze plaatsvindt, waardoor de microbiologische kwaliteit wordt beheerst.

De hygiëne paragrafen in deze GMP-standaard hebben betrekking op alle verhandelde voedermiddelen.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

De leverancier maakt in zijn administratie een duidelijk en aantoonbaar onderscheid tussen de GMP04/GMP05/GMP13 -geborgde voedermiddelen en de niet- GMP04/GMP05/GMP13 - geborgde voedermiddelen

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer koopt uitsluitend voedermiddelen van leveranciers, waarbij aantoonbaar op het moment van levering minimaal aan het volgende wordt voldaan:

De leverancier is een GMP-gecertificeerde handelaar in of producent van voedermiddelen (GMP04/GMP05).

De leverancier, zijnde een akkerbouwer, is een GMP-gecertificeerde teler ingevolge de GMP- standaard teelt van voedermiddelen (GMP11), of volgens een daarmee door het productschap verklaarde uitwisselbare kwaliteitsstandaard.

Indien de ondernemer voedermiddelen van een leverancier in het buitenland afneemt die niet aan het voorgaande voldoet, dient de leverancier gecertificeerd te zijn volgens GMP13.

Het productschap is gerechtigd de namen van de leveranciers die voldoen aan de GMP- voorwaarden als hiervoor bedoeld te publiceren.

Indien de normen voor voedermiddelen ingevolge de GMP-regeling wijzigen, gelden deze voor alle nieuwe aankopen op het moment van de inwerkingtreding ervan. Voor lopende contracten geldt (m.u.v. wettelijke eisen) een uit- zondering onder voorwaarde dat deze ten genoegen van het productschap en onverwijld en te allen tijde kunnen worden getoond en waarbij de maximale looptijd van 8 maanden niet wordt overschreden.

Indien de ondernemer mengsels van voedermiddelen verhandelt, dienen deze uitsluitend

betrokken en/of geproduceerd te zijn bij een GMP-gecertificeerd bedrijf (volgens GMP02).

4.6.2. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Er dienen uitsluitend voedermiddelen betrokken te worden van toeleveranciers die waarborgen dat voedermiddelen worden geleverd, die geen hoger gehalte aan contaminanten bevatten dan de door het bedrijf (o.b.v. de risico-analyse) vastgestelde normen. De vastgestelde normen moeten minimaal voldoen aan de normen voor ongewenste stoffen en producten in voedermiddelen zoals opgenomen in de diervoederwetgeving en de in het kader van deze regeling door het bestuur bij besluit vastgestelde normen (GMP14).

4.6.3. Hygiënisch werken [Vervallen per 01-01-2006]

Er dienen microbiologische criteria voor voedermiddelen te zijn vastgelegd, afhankelijk van het al dan niet ondergaan van een behandeling van voedermiddelen.

Wanneer geen behandeling wordt toegepast, dient de ondernemer voorts:

  • uitsluitend voedermiddelen dan wel diervoeders aan te kopen en te ontvangen van leveranciers die een zodanig kwaliteitssysteem hebben dat de microbiologische kwaliteit van de voedermiddelen is gewaarborgd en/of;

  • inzicht te hebben van de microbiologische kwaliteit van voedermiddelen af te leiden van bedrijfsinterne dan wel -externe databestanden en/of;

  • (kritische) voedermiddelen te bemonsteren te analyseren en bij het constateren van salmonella actie te ondernemen. Voor deze actie dient een procedure te zijn vastgesteld.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

-

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Opslag [Vervallen per 01-01-2006]

Op- en overslag dient plaats te vinden in een GMP-gecertificeerde bedrijfseenheid.

Indien op- en overslag bij een buitenlandse bedrijfseenheid plaatsvindt die niet aan het voorgaande voldoet, dient de ondernemer gecertificeerd te zijn volgens GMP13 of GMP06 Indien dit niet het geval is, dient de ondernemer zelf maatregelen vast te leggen en uit te voeren, die gelijkwaardige waarborgen omtrent de kwaliteit van voedermiddelen jegens zijn afnemers bieden.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Hygiënisch werken [Vervallen per 01-01-2006]

De ondernemer dient periodiek controles door middel van microbiologisch onderzoek of onderzoek naar parameters omtrent de microbiologische kwaliteit uit te voeren in de voedermiddelen (bij ontvangst of aankoop) volgens een door hem zelf vastgestelde frequentie, die tenminste in overeenstemming zijn met de bij of krachtens deze GMP-regeling vastgestelde minimum frequentie.

De controlefrequentie is afhankelijk van de aard van de producten en het productieproces, de omvang van de productie en van de resultaten van de inspecties en controles.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

4.13.1. Algemeen [Vervallen per 01-01-2006]

Als een partij voedermiddelen niet voldoet aan de door de ondernemer gestelde microbiologische criteria, dan wordt deze partij uitsluitend in het bedrijf tot diervoeder bestemd, indien het realiseren van de doelstelling van de GMP- regeling door zonodig aangepaste behandeling haalbaar blijft. Hiervoor dient een bedrijfsinterne procedure opgesteld te zijn.

Het productschap kan hiervoor bij besluit richtlijnen voorschrijven.

Wanneer adequate behandeling niet mogelijk is dient de betreffende partij voedermiddelen in een door het productschap gecertificeerd decontaminatiebedrijf gedecontamineerd te worden.

Opslagruimten waarin zich besmette partijen hebben bevonden dienen zodanig gereinigd te worden dat geen herbesmetting van volgende partijen kan plaatsvinden. Hiervoor dient een procedure vastgelegd te zijn, alsmede dienen het aanwezig zijn van besmette ruimten en de reiniging daarvan te worden geregistreerd.

4.13.2. Andere behandeling [Vervallen per 01-01-2006]

Bij het constateren van salmonella in voedermiddelen of eindproduct dient door het bedrijf actie te worden ondernomen om de oorzaak op te sporen.

Op grond hiervan dienen voorts maatregelen te worden genomen m.b.t. terugdringen van salmonella besmetting en dient eventueel het aankoopbeleid bijgesteld te worden. De genomen actie dient t.b.v. verificatie te worden vastgelegd.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

4.14.1. Hygiënisch werken [Vervallen per 01-01-2006]

Ingeval salmonella wordt waargenomen dient duidelijk te zijn welke actie door het bedrijf is genomen om de oorzaak op te sporen en welke actie is ondernomen om de bedrijfsinrichting dan wel bedrijfsvoering aan te passen.

Van deze actie dient zodanig aantekening en archivering plaats te vinden dat verificatie achteraf mogelijk is.

Als de microbiologische kwaliteit van een voedermiddel niet voldoet aan de door het bedrijf dan wel in de GMP-regeling hieraan gestelde beoordelingscriteria, dient de oorzaak te worden opgespoord en dient actie te worden ondernomen om de oorzaak weg te nemen. Hiervoor dient een procedure te zijn vastgelegd. Van de actie dient zodanig aantekening en archivering plaats te vinden dat verificatie achteraf mogelijk is.

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

Na een behandeling van voedermiddel tot aflevering dient geen herbesmetting (met salmonella) op te treden.

Bij aflevering van het voedermiddel dient naast het verstrekken van de wettelijk verplichte informatie ook informatie over voorschakels te worden verstrekt, die minimaal voldoet aan door het bestuur nader vast te stellen eisen.

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

Opslag door de afnemer: Aangegeven dient te worden op welke wijze de afnemer de geleverde producten dient op te slaan zodat bederf, microbiologische besmetting e.d. wordt voorkomen.

Aangegeven dient te worden wat de houdbaarheidstermijn is onder de te onderscheiden opslagcondities bij de afnemer.

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

06. GMP-standaard op- en overslag voedermiddelen GMP06; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

  4.3.1 Algemeen  
  4.3.2 Ongewenste stoffen en producten 3
  4.3.3 Hygiënisch werken 3
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

4

 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

4

  4.9.1 Algemeen 4
  4.9.2 Ongewenste stoffen en producten 6
  4.9.3 Hygiënisch werken 5
  4.9.4 Op- en overslag dierlijke eiwitten  
 

4.10

Keuring en Beproeving

5

 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

5

 

4.12

Keurings- en Beproevingsstatus

5

 

4.13

Beheersing van Producten met Afwijkingen

5

  4.13.1 Algemeen 5
  4.13.2 Andere behandeling 5
 

4.14

Corrigerende en preventieve Maatregelen

5

  4.14.1 Hygiënisch werken 5
 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

5

 

4.16

Beheersing van Kwaliteitsregistraties

5

 

4.17

Interne Kwaliteitsaudits

5

 

4.18

Opleiding

5

 

4.19

Nazorg

5

 

4.20

Statistische Technieken

6

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft als dienst voor derden een aanvulling voor de op- en overslag van voedermiddelen op de algemene GMP- standaard diervoedersector (GMP01).

De algemene GMP-standaard voor de diervoedersector (GMP01) is integraal van toepassing

Indien de ondernemer verrichtingen uitvoert waarvoor een aanvullende GMP-standaard bestaat (b.v. voor transport, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

4.3.1.1. Uitgangspunten [Vervallen per 01-01-2006]

De verantwoordelijkheid van het op- en over- slagbedrijf beperkt zich tot de kwaliteit van de dienst van op- en overslag van voedermiddelen.

Acceptatiebeleid van voedermiddelen voor op- en overslag staat los van de kwaliteit en conditie van voedermiddelen in relatie tot wettelijke eisen.

4.3.2. Algemeen [Vervallen per 01-01-2006]

Op- en overslagbedrijven dienen afnemers van de dienst van op- en overslag duidelijk te maken, dat zij werken volgens regels die waarborgen dat de geleverde diensten voldoen aan de eisen in wet- en regelgeving met betrekking tot voedermiddelen verband houdend met de veiligheid voor mens, dier en milieu (basiskwaliteit) en eventueel specifieke eisen die de afnemer van de dienst stelt.

Het GMP-handboek bevat minimaal een procedure voor het aannemen van een opdracht voor de op- en/of overslag van voedermiddelen.

De relevante hygiënekenmerken in relatie tot de basiskwaliteit van voedermiddelen in op- en overslag zijn bekend met betrekking tot:

  • -

    het gescheiden houden van andere voedermiddelen

  • -

    wijze van behandeling tijdens op- en overslag

  • -

    reinigingsprocedures tussen op- en overslag van onderscheidenlijke voedermiddelen Onder relevante hygiënekenmerken in relatie tot basiskwaliteit kunnen worden verstaan: temperatuur van het voedermiddelen, vochtgehalte, geur, kleur, ongedierte, e.d. Hiervoor dienen criteria te zijn vastgelegd en de te tolereren afwijkingen.

4.3.3. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem wordt gehanteerd dat aangetoond wordt, dat voor op- en overslag aangeboden voedermiddelen door het proces van op- en overslag geen nadelige veranderingen ondergaan in relatie tot basis- kwaliteit v.w.b. ongewenste stoffen en producten.

4.3.4. Hygiënisch werken [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem van bedrijfshygiëne wordt gehanteerd dat wordt aangetoond dat de kwaliteit van de dienst van op- en overslag wordt beheerst. De kwaliteit van de dienst m.b.t. de kritische punten in de bedrijfsinrichting dient binnen de door de ondernemer vastgestelde normen en eisen te worden beheerst.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

-

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

De ondernemer heeft een deugdelijke administratie waarin tenminste is opgenomen:

  • -

    de hoeveelheden en soorten voedermiddelen per opdrachtgever;

  • -

    voor zover van toepassing (kopieën van) de eventuele geleidedocument, garantieverklaringen, certificaten e.d.

  • -

    de namen van de afnemers van de dienst van op- en overslag.

Indien inkomende partijen in een zelfde opslagruimte worden opgeslagen, zonder dat betreffende opslagruimte leeg komt, dienen alle herkomstpartijen die in betreffende opslagruimte bij elkaar komen te worden geadministreerd bij de uitgaande partijen. Dit betekent dat per uitgaande partij meerdere inkomende partijen aan de orde kunnen zijn. Er dient per inkomende partij op snelle wijze inzicht te kunnen worden gegeven welke uitgaande partijen hierbij horen.

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Algemeen [Vervallen per 01-01-2006]

Voedermiddelen mogen niet met elkaar vermengd geraken, indien de basiskwaliteit hierdoor wordt aangetast. Gebeurt dit wel dan dient vastgelegd te zijn welke actie dient te worden genomen met betrekking tot het voedermiddel en naar belanghebbenden. Afwijkingen en de hierop genomen actie voor correctie moeten worden vastgelegd.

Er is een passende identificatie van transport- middelen en opslagruimtes, waarin of waaruit op- of overgeslagen of afgeleverd wordt.

In relatie tot de kwaliteit van de dienst van op- en overslag dient een procedure aanwezig te zijn voor leegdraaien van de overslagroute tussen opeenvolgende partijen voedermiddelen. In het bijzonder ingeval opeenvolgende voedermiddelen relevante verschillen in basis- kwaliteit hebben.

4.9.2. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Op- en overslag dient zodanig te zijn dat een voedermiddel niet wordt verontreinigd met ongewenste stoffen en producten. Dit dient zeer in het bijzonder gewaarborgd te worden indien eveneens andersoortige producten dan voeder- middelen worden op- en overgeslagen met de- zelfde installatie en/of in dezelfde opslagruimte. Voor zover dit afhankelijk is van de dienst van op- en overslag, dient in een procedure te worden vastgelegd op welke wijze dit wordt gerealiseerd, beheerst en gewaarborgd.

4.9.3. Hygiënisch werken [Vervallen per 01-01-2006]

De bedrijfshygiëne is zodanig dat de basiskwaliteit wordt beheerst. Dit dient zeer in het bijzon- der gewaarborgd te worden indien eveneens andersoortige goederen dan voedermiddelen (of voedermiddelen met voor de op- en overslag relevante verschillen in basiskwaliteit) worden op- en overgeslagen met dezelfde installatie en/of in dezelfde opslagruimte. In een procedure dient te worden vastgelegd op welke wijze dit wordt beheerst.

Bij voedermiddelen die in opslag liggen dient inregening te worden voorkomen. Voor het optreden hiervan dient een procedure ter correctie te zijn opgesteld. Actie en resultaat dient te zijn vastgelegd.

Er dient een procedure te zijn hoe omgegaan wordt met voorzienbare omstandigheden die de houdbaarheid en kwaliteit negatief beïnvloeden gedurende opslag.

Opslagruimten, waarin zich besmette partijen hebben bevonden, dienen zodanig gereinigd te worden dat geen besmetting van volgende partijen kan plaatsvinden. Hiervoor dient een procedure vastgesteld te zijn, alsmede dienen het aanwezig zijn geweest van besmette ruimten, de reiniging en de vrijgave daarvan te worden geregistreerd.

4.9.4. Op- en overslag dierlijke eiwitten [Vervallen per 01-01-2006]

De ondernemer die op- en overslag van voedermiddelen verzorgt, dient te waarborgen dat dierlijke eiwitten:

  • gedurende het gehele traject van inname tot verzending strikt gescheiden blijven van

  • niet in dezelfde recipiënten en silo's opgeslagen worden als

  • niet over dezelfde interne transport- en proceslijnen gevoerd worden als

andere voedermiddelen, halffabrikaten of diervoeders.

De ondernemer die op- en overslag van voedermiddelen verzorgt, dient te waarborgen dat vismeel, dicalciumfosfaat van ontvette beenderen en gehydrolyseerde eiwitten van huiden en vis:

  • gedurende het gehele traject van inname tot verzending strikt gescheiden blijven van

  • niet in dezelfde recipiënten en silo's opgeslagen worden als

  • niet over dezelfde transport- en proceslijnen gevoerd worden als

andere dierlijke eiwitten.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

-

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

Het GMP-handboek bevat voor zover van toepassing minimaal een beschrijving van de behandeling van afwijkingen bij de op- en overslag in relatie tot kwaliteit, alsmede de te ondernemen acties.

Er is een procedure vastgelegd hoe omgegaan dient te worden met voedermiddelen indien bekend is dat deze niet voldoen aan basiskwaliteit.

Indien verontreiniging met ongewenste stoffen en producten plaatsvindt moet vastgelegd zijn welke maatregelen genomen moeten worden ten aanzien van de betreffende partij en afnemer van de dienst. Het optreden van afwijkingen en de hierop genomen actie moeten worden vastgelegd.

Ingeval bij de ondernemer bekend is dat een partij voedermiddelen van niet-gezonde handelskwaliteit, in de zin van artikel 8.7 van Verordening PDV Diervoeders 1998 in op- en/of overslag is, wordt hiervan onverwijld melding gedaan aan de afnemer van de dienst.

Na het constateren van salmonella op de kritische punten in de bedrijfsinrichting dient door het bedrijf actie te worden ondernomen om de oorzaak op te sporen. Op grond hiervan dienen maatregelen te worden genomen met betrekking tot het terugdringen van salmonellabesmetting. De genomen actie dient ten behoeve van verificatie te worden vastgelegd.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

-

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

-

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

-

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

07. GMP-standaard wegtransport diervoedersector GMP07 ; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

    4.3.1 Uitgangspunten 3
    4.3.2 Algemeen 3
    4.3.3 Voorkóming van risico's van versleping van toevoegings- en diergeneesmiddelen 4
    4.3.4 Ongewenste stoffen en producten 4
    4.3.5 Hygiënisch werken 4
 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

4

 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid van Producten

4

 

4.9

Procesbeheersing

5

    4.9.1 Algemeen 5
    4.9.2 Ongewenste stoffen en producten 5
    4.9.3 Hygiënisch werken 5
    4.9.4 Transportvolgorde, samenlading, reiniging en desinfectie 6
 

4.10

Keuring en Beproeving

8

 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

9

 

4.12

Keurings- en Beproevingsstatus

9

 

4.13

Beheersing van Producten met Afwijkingen

9

 

4.14

Corrigerende en preventieve Maatregelen

9

 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

9

 

4.16

Beheersing van Kwaliteitsregistraties

9

 

4.17

Interne Kwaliteitsaudits

9

 

4.18

Opleiding

9

 

4.19

Nazorg

9

 

4.20

Statistische Technieken

9

5 Bijlage I: Reiniging, desinfectie en beladingsvolgorde transport diervoeders 10
 

5.1

Annex A: Voorschriften ten aanzien van transportvolgorde, samenlading, reiniging en desinfectie

11

 

5.2

Annex B: Categorie-indeling van stoffen/materialen

13

 

5.3

Annex C: Procedure (her-)indeling producten in ladingcategorieën transport

21

 

5.4

Annex D: Residubemonstering en -bepaling laadruimten na transport producten, waarvoor een (her)indeling in ladingcategorieën wordt verzocht (wegtransport)

24

 

5.5

Annex E: Procedure voor toelating laadruimtes na transport van verboden ladingen

25

 

5.6

Annex F: Protocollen i.r.t. het transport van stapelbare pluimvee- en paardenmest

26

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling voor ondernemers (leveranciers of ontvangers) die opdracht nemen voor of geven tot het transport van voedermiddelen, voormengsels, diervoeders en toevoegingsmiddelen over de weg op de algemene GMP-standaard diervoedersector (GMP01)

De algemene GMP-standaard diervoedersector (GMP01) is integraal van toepassing, voor zover van toepassing

Wanneer een ontvanger van voedermiddelen deze producten afneemt van een niet-GMP- gecertificeerde leverancier die de opdracht geeft voor het transport, dan dient de ontvanger aantoonbaar met de leverancier af te spreken dat het transport van de voedermiddelen plaatsvindt conform het bepaalde in deze aanvullende standaard.

Indien de ondernemer andere verrichtingen uitvoert waarvoor een aanvullende GMP- standaard bestaat (b.v. voor transport, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

Vanwege de verschillen in de structuur en karakter van de verschillende vormen van vervoer is een opsplitsing gemaakt tussen de volgende vormen van transport:

  • 1. Wegvervoer (GMP07)

  • 2. Zeescheepvaart, binnenvaart en railvervoer (GMP08)

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

-

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

4.3.1. Uitgangspunten [Vervallen per 01-01-2006]

De verantwoordelijkheid van de ondernemer die het transport uitvoert, beperkt zich binnen deze standaard uitsluitend tot de dienst van transport van voedermiddelen, mengvoeders en voormengsels. Deze dienst kan uitgevoerd worden door een extern ingeschakeld (transport-)bedrijf, doch eveneens door een GMP- gecertificeerde diervoederleverancier zélf met eigen vervoer.

Indien het transport door eigen vervoer van een GMP-gecertificeerde ondernemer wordt verricht, dient de GMP-certificatie voor de betreffende ondernemer ook betrekking te hebben op het transport, waarbij aantoonbaar aan de voorwaarden ingevolge de GMP-regeling voldaan dient te worden.

Indien het transport wordt verzorgd door een extern ingeschakeld (transport-)bedrijf. dient dit bedrijf aantoonbaar aan de voorwaarden ingevolge deze GMP-regeling te voldoen. Vereist is dat deze transporteur beschikt over een certificaat van een onafhankelijke instantie die door het productschap is geaccepteerd.

Uitgezonderd van de (certificerings-)voorwaarde(n) ingevolge de GMP-regeling zijn extern ingeschakelde bedrijven die louter voor verpakte producten worden ingezet.

Acceptatiebeleid van een op vorenbedoelde wijze gecertificeerde transporteur staat los van de kwaliteit en conditie van deze producten in relatie tot wettelijke eisen voor deze producten.

4.3.2. Algemeen [Vervallen per 01-01-2006]

Transportbedrijven dienen afnemers van de buiktransportdienst duidelijk te maken, dat zij werken volgens regels die waarborgen dat de geleverde dienst voldoet aan de GMP-eisen en wet- en regelgeving met betrekking tot voedermiddelen, mengvoeders en voormengsels, verband houdend met de veiligheid voor mens, dier en milieu (basiskwaliteit) en eventueel specifieke eisen die de afnemer van de dienst stelt.

Het GMP-handboek bevat voor de verrichting transport minimaal een procedure voor het aannemen van een opdracht voor het transport van voedermiddelen, mengvoeders en voormengsels.

De ondernemer die buiktransport uitvoert van voedermiddelen, voormengsels en mengvoeders dient vast te stellen welke de relevante kenmerken van deze producten zijn met betrekking tot de noodzaak tot het gescheiden houden van producten en de benodigde reinigings- en ontsmettingsprocedures tussen opeenvolgende ladingen10. Ten behoeve van de toepassing van de juiste procedures wat betreft scheiding van producten en reiniging en ontsmetting zijn criteria vastgesteld, alsmede toleranties voor afwijkingen. Relevante kenmerken kunnen in dit kader onder meer zijn: vochtgehalte, temperatuur, geur, kleur en de aanwezigheid van ongedierte.

V.w.b. transport van verpakte producten is voldoende dat het laadcompartiment schoon is, d.w.z.: volledig geleegd en vrij van ladingsrestanten en geur van voorafgaande ladingen en droog/gedroogd.

4.3.3. Voorkóming van risico's van versleping van toevoegings- en diergeneesmiddelen [Vervallen per 01-01-2006]

Er wordt een systeem van registratie van transportvolgordes en reiniging tussen opvolgende buiktransporten gebruikt. Doel is te waarborgen dat eerder getransporteerde mengvoeders, voormengsels of voedermiddelen géén overschrijding veroorzaken van maximum kruiscontaminatie-niveau's aan toevoegings- en diergeneesmiddelen in opvolgend getransporteerde mengvoeders, voormengsels of voedermiddelen.

4.3.4. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem wordt gebruikt dat aangetoond wordt, dat voor transport aangeboden voedermiddelen, mengvoeders en voormengsels door het transport geen nadelige veranderingen ondergaan in relatie tot basiskwaliteit v.w.b. ongewenste stoffen en producten.

4.3.5. Hygiënisch werken [Vervallen per 01-01-2006]

Doel is dat een zodanig systeem van hygiëne wordt gebruikt, dat wordt aangetoond dat de kwaliteit van de transportdienst wordt beheerst. De kwaliteit van de dienst dient op kritische punten binnen de door de ondernemer vastgestelde normen en eisen te worden beheerst.

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

-

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

De ondernemer dient bij de transportopdracht van de opdrachtgever informatie m.b.t. de productcategorieën, incl. de GMP-coderingen in het kader van transport te ontvangen zoals vastgelegd in de bijlage bij deze standaard. Dit betreft zowel de standaard die relevant is voor beoordeling als categorie 'volgende vracht' als de standaard die relevant is voor beoordeling als categorie 'vorige vracht'.

De ondernemer die het transport uitvoert heeft een deugdelijke administratie waarin tenminste is opgenomen:

  • a. de hoeveelheden en soorten producten11 per opdrachtgever (d.i. de afnemer van de dienst van het transport);

  • b. voor zover van toepassing kopieën van de eventuele geleidedocumenten, garantieverklaringen, certificaten e.d.;

  • c. de laad- en losadressen;

  • d. de identificatie en codering van de bulk-laadcompartimenten, waarmee de transportvolgorde van bulkgoederenvervoer mogelijk blijft.

De bovengenoemde gegevens inzake opdrachtgevers, laad- en losadressen mogen eventueel gecodeerd worden geadministreerd,

mits voor de externe toezichthouders elders in de administratie inzicht kan worden gegeven in de achterliggende gegevens van de gebruikte standaarden.

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Algemeen [Vervallen per 01-01-2006]

Voedermiddelen respectievelijk mengvoeders respectievelijk voormengseis mogen (bij gecombineerd vervoer) niet met elkaar vermengd geraken, indien de basiskwaliteit hierdoorwordt aangetast12. Gebeurt dit wel, dan dient vastgelegd te zijn welke actie dient te worden genomen met betrekking tot het voedermiddel, voormengsel onderscheidelijk mengvoeder en naar belanghebbenden. Afwijkingen en de hierop genomen actie voor correctie moeten worden vastgelegd.

Er is een passende identificatie van bulk-laadcompartimenten en traceerbaarheid van transportvolgorde van producten in de betreffende laadcompartimenten, via onder meer bijvoorbeeld codering van de laadcompartimenten en via rittenstaten, al dan niet in elektronische vorm aanwezig bij het transportmiddel.

Voorafgaande ladingen dienen bij buiktransport door de chauffeur per laadcompartiment te worden geregistreerd in een rittenstaat, al dan niet in elektronische vorm, 'op het transportmiddel' en een reinigingsprocedure dient te worden vastgelegd, waarmee aantoonbaar wordt voldaan aan de wettelijke eisen en aanvullende normen13 voor reiniging (en desinfectie) van transportmiddelen in de GMP-regeling.

In zijn algemeenheid geldt, dat de laadruimte schoon dient te zijn, waarmee wordt bedoeld: volledig geleegd en vrij van ladingsrestanten en geur van voorafgaande ladingen en droog/gedroogd ingeval van droge vervolgladingen. De chauffeur dient dit visueel vóór elk transport van (dier-)voeder(-middelen) te controleren.

De reinigings- en desinfectiehandelingen dienen door de chauffeur per bulk-laadcompartiment te worden aangetekend en geparafeerd in de rittenstaten, al dan niet in elektronische vorm. Het resultaat van de reinigings- en desinfectiehandelingen dient visueel te worden beoordeeld en bij de voorafgaande ladingen

en de reinings- en desinfectiehandelingen in de rittenstaten te worden geregistreerd.

De gegevens in de rittenstaten worden later overgenomen in het logboek ten kantore van het transportbedrijf. Dit kan geschieden via een eenvoudige bundeling van de rittenstaten en dient minimaal een maal per maand te uitgevoerd te worden.

Het logboek (met de rittenstaten) dient minimaal gedurende zeven jaar te worden bewaard.

4.9.2. Ongewenste stoffen en producten [Vervallen per 01-01-2006]

Het transport wordt dusdanig uitgevoerd, dat een voedermiddel, voormengsel of mengvoeder niet wordt verontreinigd met ongewenste stoffen en producten. Dit dient zeer in het bijzonder gewaarborgd te worden indien in dezelfde laadruimte eveneens andersoortige producten dan voedermiddelen respectievelijk mengvoeders respectievelijk voormengseis (of voedermiddelen respectievelijk mengvoeders respectievelijk voormengseis met voor het transport relevante verschillen in basiskwaliteit m.b.t. ongewenste stoffen) worden getransporteerd14 . Voor zover dit afhankelijk is van het transport, dient in een procedure te worden vastgelegd op welke wijze dit wordt gerealiseerd, beheerst en gewaarborgd.

4.9.3. Hygiënisch werken [Vervallen per 01-01-2006]

Het transport wordt dusdanig uitgevoerd, dat de basiskwaliteit m.b.t. hygiëne wordt beheerst. Dit dient zeer in het bijzonder gewaarborgd te worden indien in dezelfde laadruimte eveneens andersoortige goederen dan voedermiddelen respectievelijk mengvoeders respectievelijk voormengseis (of voedermiddelen respectievelijk mengvoeders respectievelijk voormengseis met voor het transport relevante verschillen in microbiologische basiskwaliteit) worden getransporteerd15 . In een procedure dient te worden vastgelegd op welke wijze dit wordt beheerst.

Bij droge voedermiddelen, mengvoeders en voormengseis dient tijdens transport inregening en spatwater te worden voorkómen. Voor het optreden hiervan dient een procedure te zijn opgesteld. Actie en resultaat dienen te zijn vastgelegd. Bij transport van droge voedermiddelen, mengvoeders en voormengseis in bulk, dienen laadcompartimenten, ook indien ze leeg zijn, afgedekt te worden, opdat inregenen en besmetting met uitwerpselen van vogels wordt tegengegaan. Indien afdekking van lege laadruimtes niet mogelijk is, dient de laadruimte voorafgaand aan belading te worden droog getrokken en zonodig daarvoor te worden schoongespoten. Te gebruiken afdekzeilen voor laadcompartimenten dienen voor buikbelading schoon en voor belading met droge voedermiddelen, mengvoeders en voormengsels bovendien ook droog te zijn.

Voorts dient de buitenzijde van transportmiddelen, inclusief chassis, voorafgaand aan transport van voedermiddelen, mengvoeders en voormengsels vrij te zijn van zichtbare delen van de voorafgaande lading.

Er dient een procedure te zijn hoe omgegaan wordt met voorziene omstandigheden die de houdbaarheid en kwaliteit negatief beïnvloeden gedurende transport.

Bulk-laadcompartimenten waarin zich (met ongewenste stoffen/producten en/of ziektekiemen) gecontamineerde partijen hebben bevonden, dienen zodanig gereinigd te worden dat géén besmetting van volgende partijen kan plaatsvinden. Hiervoor dienen registraties van de uitgevoerde reinigingen en desinfecties beschikbaar te zijn. Er is een reinigingsprocedure waarmee aantoonbaar wordt voldaan aan de wettelijke eisen en normen16 voor reiniging (en ontstmetting) van transportmiddelen in de GMP-regeling.

4.9.4. Transportvolgorde, samenlading reiniging en desinfectie [Vervallen per 01-01-2006]

4.9.4.1. Algemeen [Vervallen per 01-01-2006]

Voorafgaand aan belading van buikcompartimenten dient de productcategorie van de voorgaande ladingen en van de nieuwe lading te worden vastgesteld, waarbij voldaan dient te worden aan in de bijlage bij deze standaard vastgestelde reiniging- en desinfectieregime en de beladingsvolgorde.

Er worden 4 hoofdcategorieën van voorafgaande ladingen onderscheiden:

  • 1. Materiaal met zeer hoog risico

  • 2. Microbiologisch verontreinigd materiaal

  • 3. Materialen met fysisch en/of chemisch risico

  • 4. Neutrale materialen

De transporteur moet kunnen aantonen dat in het verleden in een laadcompartiment geen 'verboden ladingen' uit productcategorie 1 zijn getransporteerd. Na een verboden lading mogen geen voedermiddelen, mengvoeders of voormengsels worden getransporteerd, tenzij het transportmiddel /-de laadruimte daarvoor wordt gecertificeerd volgens de procedure zoals vastgesteld in de bijlage bij deze standaard.

Na transport van producten uit categorie 2 dient te allen tijde te worden gedesinfecteerd, voorafgaand aan de eerste vervolglading.

Voor het overige dient te worden geverifieerd of na de laatste natte reiniging nog producten uit categorie 3 zijn getransporteerd. Zo ja, dan dient alsnog een reiniging met water te volgen

Vóór elk diervoedertransport moet visueel worden gecontroleerd of het laadcompartiment schoon is, dat wil zeggen volledig geleegd en vrij van restanten materiaal en geur van voorgaande ladingen en droog of gedroogd ingeval van droge vervolgladingen.

4.9.4.2. Basisprincipes voor reiniging en desinfectie [Vervallen per 01-01-2006]

In het in de bijlage bij deze standaard vastgestelde reiniging- en desinfectieregime en beladingsvolgorde worden de volgende basisprincipes voor reiniging en desinfectie onderscheiden.

  • a. Droge reiniging

  • b. Reiniging met water

  • c. Reiniging met water en reinigingsmiddel

  • d. Desinfectie direct, of na één van de reinigingsregimes A, B, of C

Een desinfectie (D) is alleen noodzakelijk in geval van voorgaande ladingen die in microbiologisch opzicht onacceptabel zijn (waarneembare bederfverschijnselen) of waarvan bekend is dat daarin ziekteverwekkende micro-organismen, zoals Salmonella, aanwezig zijn.

Reinigingsregime A (droge reiniging) [Vervallen per 01-01-2006]

Ingeval van transport van alleen droge "neutrale" stoffen kan een droge reiniging voldoende zijn en zowel vanuit praktisch als microbiologisch oogpunt voordelen bieden.

Bij een droge reiniging wordt het transportmiddel na lossen gereinigd door zuigen, uitblazen of vegen. Het zuigen heeft hierbij de voorkeur omdat daarbij geen verspreiding van het vuil optreedt. Moeilijk bereikbare plekken dienen zo nodig manueel met een stoffer of iets dergelijks aanvullend te worden gereinigd. Indien na reiniging het resultaat onvoldoende blijkt, zal alsnog moeten worden overgeschakeld op een natte reiniging.

Reinigingsregime B (reiniging met water) [Vervallen per 01-01-2006]

Na het transport van bijvoorbeeld vochthoudende, plakkende stoffen of mogelijk schadelijke chemicaliën is een reiniging met water noodzakelijk. Bij open transportmiddelen kan het beste gebruik worden gemaakt van een hogedrukreiniger met vlakstraalnozzie met een druk van minimaal 25 bar of hoger indien noodzakelijk. Gebruik in geval van verwijdering van chemicaliën (bijv. chemisch samengestelde kunstmest) bij voorkeur warm water met een temperatuur van 60 °C of hoger om de oplosbaarheid van chemicaliën te vergroten. Moeilijk bereikbare plaatsen dienen zo nodig met geschikte hulpmiddelen, zoals borstels, afzonderlijk te worden schoongemaakt. Bij het reinigen is het van belang dat het water weg kan lopen. Laat het transportmiddel afhankelijk van de aard van de vervolglading drogen door voldoende ventilatie of gebruik van een hete luchtkanon.

De algemene reinigingsprocedure is hierbij als volgt:

  • a. restanten van de voorgaande lading zoveel en zo droog mogelijk verwijderen

  • b. voorspoelen met koud of indien nodig warm water en moeilijk bereikbare plaatsen handmatig reinigen

  • c. hogedruk reiniging met water

  • d. drogen

Reinigingsregime C (Reiniging met water en reinigingsmiddel) [Vervallen per 01-01-2006]

Ingeval van eiwitrijke of vette ladingen is het gebruik van een reinigingsmiddel noodzakelijk. Om vetten makkelijker te kunnen verwijderen is een verhoogde watertemperatuur nodig. Deze mag echter niet hoger zijn dan 60 °C om het coaguleren van eiwitten, en daardoor hechten aan oppervlakken, te voorkomen. Om het verwijderen van vetten en eiwitten te vergemakkelijken wordt een matig tot sterk alkalisch reinigingsmiddel geadviseerd in de door de fabrikant voorgeschreven dosering.

In open systemen (kip/bakwagen) kan het beste een schuimend ontvettend middel worden gebruikt. In geval van tankcleaning met sproeibollen mag juist geen schuimend middel worden ingezet, maar kan beter worden gewerkt met een zogenaamd Cleaning In Place (CIP) reinigingsmiddel bij verhoogde temperatuur. In specifieke gevallen, zoals het verwijderen van kalkhoudende materialen, verdient een zuur reinigingsmiddel de voorkeur.

De algemene reinigingsprocedure is hierbij als volgt:

  • a. restanten van de voorgaande lading zoveel en zo droog mogelijk verwijderen

  • b. voorspoelen met warm water (max. 60 °C) en moeilijk bereikbare plaatsen handmatig reinigen

  • c. inschuimen of ingellen met een reinigingsmiddel ingeval van kip/bakwagens of spoelen met CIP reinigingsmiddel bij 80 °C ingeval van tankcleaning

  • d. naspoelen met water van circa 60 °C

  • e. zonodig drogen door ventilatie of hete lucht kanon

Reinigingsregime D (Reiniging met water en reinigingsmiddel en desinfectie) [Vervallen per 01-01-2006]

Indien vanuit microbiologische overwegingen een desinfectie noodzakelijk is kan dit in de meeste gevallen alleen effectief worden uitgevoerd na een reiniging met water en reinigingsmiddel zoals hierboven is aangegeven. Een andere vorm van desinfecteren (bijvoorbeeld droog) mag alleen worden toegepast indien de effectiviteit daarvan is vastgesteld. In alle gevallen mag daarbij alleen gebruik worden gemaakt van een wettelijk toegelaten desinfectiemiddel, in de volgens de gebruiksaanwijzing aangegeven dosering.

Onderscheid kan worden gemaakt tussen desinfectiemiddelen die zijn getest op bactericide en fungicide werking en desinfectiemiddelen die zijn getest op bactericide, fungicide en virucide werking. De laatste groep mag uitsluitend worden gebruikt in de veesector. Voor transportmiddelen voor veevoeders is gebruik van een desinfectiemiddel goedgekeurd voor de voedingsmiddelenindustrie het enig overblijvende alternatief.

Alleen bij gladde makkelijk te reinigen oppervlakken, zoals RVS, kan een gecombineerd reinigings- en desinfectiemiddel op basis van actief chloor worden ingezet.

In andere gevallen is het altijd beter om eerst te reinigen en vervolgens te desinfecteren, waarbij voor de desinfectie van open transportmiddelen in eerste instantie desinfectiemiddelen op basis van actief chloor worden aanbevolen. In sommige gevallen is het gebruik van een chloorhoudend middel niet aan te raden, zoals ingeval van materialen die makkelijk corroderen of na een zure reiniging in verband met het ontstaan van giftige chloorgassen In dit geval kan gebruik worden gemaakt van quaternaire ammoniumverbindingen, met uitzondering van tankcleaning met sproeibollen, vanwege het optreden van schuimvorming. Het voordeel van deze quats is dat ze beter hechten en dus langer inwerken, het nadeel is dat de middelen moeilijker verwijderbaar zijn.

Bij gesloten tankwagens kan gebruik van perazijnzuur worden overwogen. Het voordeel van perazijnzuur is dat dit middel minder makkelijk wordt geïnactiveerd door achterblijvende vervuiling dan bij actief chloor het geval is. Als nadeel hierbij moet de penetrante geur en de aantasting van rubbers worden vermeld. Als inwerkingstijd voor desinfectantia moet tenminste 5 minuten worden aangehouden.

In de voedingsmiddelenindustrie is voorgeschreven dat na desinfectie altijd moet worden nagespoeld. Om het risico van residuen te voorkomen, verdient het aanbeveling dit voorschrift ook bij transportauto's toe te passen, tenzij kan worden aangetoond dat residuen geen risico vormen. In sommige gevallen kan namelijk door verwijdering van het desinfectans ontwikkeling van overlevende bacteriën plaats vinden wanneer het oppervlak te lang vochtig blijft.

4.9.4.3. Uitwerking basisprincipes (voor reiniging en desinfectie) en validatie [Vervallen per 01-01-2006]

De ondernemer die het transport uitvoert, dient de toepassing van deze basisprincipes per type transportmiddel gedetailleerd in een reinigingsprotocol uit te werken. In dit reinigingsprotocol moet gedetailleerd worden beschreven hoe de verschillende reinigingsregimes afhankelijk van de voorgaande lading worden uitgevoerd. In dit reinigingsprotocol moet met name aandacht worden besteed aan moeilijk reinigbare plekken, zoals pijpen, slangen, kieren, pompen, dode hoeken etc. Deze aandachtspunten dienen per type transportmiddel in het protocol te worden benoemd, waarbij moet worden aangegeven welke onderdelen vóór aanvang van de reiniging behoren te worden gedemonteerd. Adviezen met betrekking tot specifieke werkwijzen en de te gebruiken middelen kunnen worden ingewonnen bij met name de grotere leveranciers van reinigings- en desinfectiemiddelen.

Elk reinigingsprotocol dat voor een bepaalde transportruimte is opgesteld moet op effectiviteit worden gecontroleerd (gevalideerd). Daarna kan dit reinigingsprotocol voor ieder gelijk geconstrueerde transportruimte als officiële reinigingsmethode worden gehanteerd.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

Na elk reinigingsregime dient in ieder geval een visuele inspectie te worden verricht. Het resultaat van deze beoordeling dient naast de registratie van de ladingen die zijn getransporteerd en de toegepaste tussentijdse reinigings- regimes met gebruikte reinigings- en desinfectiemiddelen in het logboek te worden vermeld. Bij tankwagens is als extra controle een verzegeling mogelijk na de uitgevoerde reiniging.

Na reiniging van diermeelbevattende ladingen17 dient minimaal volgens de bij of krachtens de GMP-regeling vastgestelde frequentie een controle worden verricht op restanten van bestanddelen van dierlijke oorsprong in diervoeders volgens de in Richtlijn 98/88/EG aangegeven microscopische screeningsmethode.

Daarnaast dienen minimaal volgens de bij krachtens de GMP-regeling vastgestelde frequenties aanvullende controles worden verricht om de effectiviteit van de gehanteerde reiniging en/of desinfectie methode te beoordelen. Voor de beoordeling van de reiniging kan gebruik gemaakt worden van ATP (Adenosine Tri Phosphate) metingen. ATP is aanwezig in alle dierlijke en plantaardige cellen en kan daarom als indicator gebruikt worden voor de mate van resterende biologische vervuiling op oppervlakken. De ATP bepaling op zich is zeer eenvoudig en kan binnen enkele minuten een uitslag geven. Het reinigingsresultaat is voldoende indien het resultaat van de ATP-meting niet hoger is dan 1000 RLU. Ingeval van transport van chemicaliën is toepassing van ATP bepaling in de meeste gevallen niet zinvol. Ter verificatie van de effectiviteit van een bepaalde gehanteerde desinfectietechniek kan gebruik gemaakt worden van agarstempels, waarmee aantallen overlevende micro-organismen kunnen worden bepaald. Bij deze techniek zijn de resultaten pas na een dag bekend, waardoor een eventueel noodzakelijke aanpassing van het desinfectieproces pas achteraf kan plaatsvinden.

Voor controle op chemische residuen en pesticiden dienen minimaal volgens de door de voorzitter vastgestelde frequenties meer geavanceerde bepalingsmethoden, zoals HPLC en Massa Spectrometrie (MS), worden ingezet.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

Het GMP-handboek bevat voor zover van toepassing minimaal een beschrijving van de behandeling van afwijkingen bij het transport in relatie tot kwaliteit, alsmede het stellen van acties.

Er is een procedure vastgelegd hoe omgegaan dient te worden met voedermiddelen, voormengsels en mengvoeders, indien bekend is dat deze niet voldoen aan basiskwaliteit.

Indien verontreiniging met ongewenste stoffen en producten plaatsvindt moet vastgelegd zijn, welke maatregelen genomen moeten worden m.b.t. de betreffende partij en afnemer van de dienst. Het optreden van afwijkingen en de hierop genomen actie moeten worden vastgelegd. Ingeval bij de ondernemer die het transport uitvoert bekend is dat een partij voedermiddelen respectievelijk mengvoeders van niet-gezonde handelskwaliteit in de zin van Richtlijn 1999/29/EG inzake ongewenste stoffen en producten in diervoeding is, wordt hiervan onverwijld melding gedaan aan de afnemer van de dienst.

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

-

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

-

4.16. Beheersing van kwaliteitsregistratie [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

-

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

5. Bijlage I: reiniging, desinfectie en beladingsvolgorde transport diervoeders [Vervallen per 01-01-2006]

Doel: [Vervallen per 01-01-2006]

Deze bijlage betreft voorschriften met betrekking tot reiniging, desinfectie en beladingsvolgorde bij wegtransport van diervoeders, welke behoren tot de GMP-standaard wegtransport diervoedersector (GMP07).

Voorwaarden: [Vervallen per 01-01-2006]

  • 1. Het reinigings- en desinfectieregime en de beladingsvolgorde van laadruimten bij buikladingen, zoals bedoeld in de GMP-standaard wegtransport diervoedersector (GMP07), paragraaf 4.9.4. vindt plaats overeenkomstig het bepaalde in annex A bij deze bijlage.

  • 2. De ondernemer die het transport uitvoert stelt aan de hand van de productcategorieën als bedoeld in annex A, de kolommen 'voorafgaande vracht' en de categorie diervoeders als bedoeld in annex A, de kolommen 'volgende vracht' het basisprincipe voor reiniging en desinfectie vast.

  • 3. Voor de indeling van producten in productcategorieën dient gebruik gemaakt te worden van de categorisering in annex B. Producten die niet vóórkomen in een van de categorieën 2, 3 of 4 van annex B zijn verboden als lading voor transportmiddelen waarmee ook diervoeders worden vervoerd.

  • 4. De ondernemer die transport uitvoert met buiktankwagens, inspecteert minimaal 1 maal per kwartaal de volledige binnenzijde van de bulktank op mogelijk aanwezige aanslag en verwijdert aanwezige aanslag via een geschikt reinigingsregime

  • 5. Wijziging van het reinigings- en desinfectieregime vindt plaats overeenkomstig de procedure, zoals vastgelegd in annex C.

  • 6. De toelating van laadruimtes na het transport van ladingen die niet voldoen aan het het voorgaande, , geschiedt overeenkomstig de procedure, zoals vastgelegd in annex E.

In GMP07 van de GMP-regeling (aanvullende standaard voor het wegtransport) zijn voorschriften inzake voorgaande ladingen en reiniging en desinfectie van transportmiddelen opgenomen. Doel van deze voorschriften is het beheersen van risico's van kruisbesmetting voor diervoeders. Met het oog hierop zijn potentiële ladingsoorten in categorieën onderscheiden die bepalend zijn voor de reinigings- en desinfectieregimes die dienen te worden toegepast.

Veel van de voorkomende ('non-feed'-)ladingsoorten bij diervoedertransporteurs zijn ingedeeld in een viertal hoofdcategorieën van producten. Voorts zijn een viertal basisprincipes voor reiniging en desinfectie opgesteld, waarvan moet worden uitgegaan, afhankelijk van de categorieën 'voorladingen'. Voorgaande is opgenomen in annex A en B, behorend bij deze standaard.

Vanwege het feit dat met name de lijst van in categorieën ingedeelde ladingsoorten in de loop van de tijd kan wijzigen, is in de GMP-regeling opgenomen dat de voorschriften inzake reiniging en desinfectie per situatie van (typen) voorafgaande ladingen en vervolgladingen worden gespecificeerd.

In annex C is een procedure opgenomen voor indeling van nog niet afdoende beoordeelde producten of herindeling van producten. Annex E bevat een procedure voor toelating van laadruimtes na transport van verboden ladingen. Deze annex is inhoudelijk gebaseerd op het TNO-adviesrapport "Reiniging en desinfectie bij het transport van diervoeder in het kader van gezondheidsrisico's" (2000).

5.1. Annex A: Voorschriften ten aanzien van transportvolgorde, samenlading, reiniging en desinfectie [Vervallen per 01-01-2006]

Codering productcategorie

Voorafgaande vracht

Volgende vracht

Standaard

Uitzonderingen

 

Omschrijving productcategorie

Aard materiaal

Mengvoeders, voormengsels en voedermiddelen

Mengvoeders en voormengsels voor legpluimvee

Japanstandaard- Voeders, voormengsels voor vleesvarkens

S

L

J

1

Materiaal met zeer hoog risico ('exclusion list')

 

Niet toegestaan

   

2

Microbiologisch verontreinigd materiaal (m.n. Salmonella of waarneembare bederfverschijnselen, zoals geurafwijkingen)

Geen resten na lossen

D

Resten na lossen

A+D

Resten na droog reinigen

B+D

(geur)resten na reiniging met water

C+D

3 (O)

Materialen met fysisch en/of chemisch risico

Geen resten na lossen

B

   

(geur)resten na reiniging met water

C

3 (E)

(Producten met) verwerkte dierlijke eiwitten18 , m.u.v.: melk- en zuivelproducten; ei en eiproducten; toevoegingsmiddelen, omhuld

 

C

   

4(N)

Neutrale materialen

Geen resten na lossen

Geen R&O nodig

   
 

Resten na lossen

A

Resten na droog reinigen

B

Resten na reinigen met water

C

4(T1)

Mengvoeders met nicarbazine

Geen resten na lossen

Geen R&O nodig

Niet toegestaan19

Niet toegestaan20

Resten na lossen

A

4(T2)

Gemedicineerde voeders met sulfamiddelen

Geen resten na lossen

Geen R&O nodig

 

Niet toegestaan21

Resten na lossen

A

O = Ongewenste stoffen en producten (zware metalen, pesticiden-residuen, schimmeltoxinen e.d.) en andere (potentieel) schadelijke materialen (fysisch en/of chemisch).

E = residuenrisico verboden dierlijk Eiwit

N = Neutraal

T = Toevoegingsmiddelen-/diergeneesmiddelenrisico

S = Standaard

H = Herkauwer-bestemming

L = Legpluimvee-voer/-voormengsel

J = Japanvoer/-voormengsel

A = Droge reigiging

B = Reiniging met water

C = Reiniging met water en reinigingsmiddel

D = Desinfectie

5.2. Annex B: Categorie-indeling van stoffen/materialen [Vervallen per 01-01-2006]

Categorie 1 ("Haulage Exclusion List")
Dierlijk materiaal:
  • 1. Hoog Risico Materiaal (afkomstig van ongekeurde of afgekeurde dieren)

  • 2. Laag Risico Materiaal (slachtbijproducten van goedgekeurde slachtdieren)

  • 3. Specifiek Risico Materiaal (BSE gevoelig materiaal)

  • 4. Behandelde huiden en afval hiervan

  • 5. (Producten met) dierlijke eiwitten22 - voor laadruimtes met 'walking floors-systeem'23

Meststoffen:
  • 1. Dierlijke mest

  • 2. Tuinaarde/potgrond bemest met dierlijke mest

Andere (anorganische) stoffen:
  • 1. Asbest of asbest bevattende materialen

  • 2. Asfall (vers) en puinasfalt

  • 3. Metaalschroten en draaisels (niet ontvet, gewassen en gedroogd)

  • 4. Minerale klei, die is gebruikt voor detoxificatie

  • 5. Petroleumcokes

  • 8. Quakerol-olie

  • 7. Radio-actief materiaal

  • 8. Toxische oxidatieve materialen en verpakkingsmateriaal hiervan

  • 9. Vliegas

Andere (organische) stoffen:
  • 1. Huishoudelijk afval

  • 2. Jayflex Ftalaatester

  • 3. Onbehandelde voedselresten (swill)

  • 4. Onverpakte zaden, behandeld met toxische stoffen

  • 5. Rioolslib

Categorie 2
  • 1. Champignonsubstraten24

  • 2 GFT-compost25

  • 3. Glasbakglas, bestemd voor recycling

  • 4. Materialen, die met Salmonella of andere ziekteverwekkers besmet zijn.

  • 5. Materialen met waarneembare bederfverschijnselen (bv. afwijkende geur)

  • 6. Stapelbare (onbewerkte) pluimveemest en paardenmest26

Categorie 3

Meststoffen 27 :

  • 1. Ammoniumnitraat 27 %28

  • 2. Ammoniumnitraat 33,5 %29

  • 3. Chamspost

  • 4. Gehygiëniseerde (bulk)mestproducten (pathogeen vrij, uit een gecertificeerde inrichting, (EG richtlijn 92/118/EEG))30

  • 5. Gehygiëniseerde (bulk)mestproducten (pathogeen vrij, met een productcertificaat)31 -

  • 6. Kalkammonsalpeter32

  • 7. Magnesamonsalpeter33

  • 8. Mestkorrels en granulaat (pathogeen vrij, uit een gecertificeerde inrichting, (EG richtlijn 92/118/EEG))34

  • 9. Organische mestkorrels

  • 10. Zwavelzuur ammoniak

Producten m.b.t. grond:
  • 1. Groencompost

  • 2. Tuinaarde/potgrond, bemest met meststoffen uit categorie 3

  • 3. Tuinaarde/potgrond, verbeterd met groencompost

Toevoegmiddelen

Alle toevoegmiddelen uit de lijst met toegelaten toevoegingsmiddelen

  • 1. Andere (anorganische) stoffen/producten:

    '

  • 2. A!uminiumhydroxyde-poeder (99.5%, Na2O < 5000 ppm)

  • 3. Aluminiumsulfaat

  • 4. Ammoniumhydroxide (ammonia, ammoniakoplossing) (Cas-nr. 1326-21-6)35

  • 5. Ball clay

  • 6. Bentoniet

  • 7. Bleekaarde

  • 8. Bouw en sloopafval, residu bouw en sloopafval

  • 9. Calciumchloride-oplossing (Cas-nr 10043-52-4)36

  • 10. Calciumnydroxide Ca(OH) 2(Cas-nr. 1308-31-2)37

  • 11. Chromite (Fe, Mg)O. (CR, AI)2O3(Cas-nr. 1308-31-2)

  • 12. Diatomeenaarde/kiezelgur/kiezelzuur

    j

  • 13. Fosforzuur (orthofosforzuur) (Cas-nr. 7664-38-2)38

  • 14. Fosforzuurglps

  • 15. Gecalcineerd bauxiet (poeder)

  • 16. Geplette blikies (drankblikjes)

  • 17. Gerecycled glas

  • 18. IJzercarbonaat FeCO 3 - Siderite (CAS-nr. 563-71-3)

  • 19. IJzeroxide Fe 2O3 - Hematite (CAS-nr. 1317-60-8)

  • 20. IJzer(2)sulfaat, heptahydraat-kristallen

  • 21. Kaliumcarbonaat

  • 22. Kaliumchloride

  • 23. Kaliumhydroxide (kaliloog) (Cas-nr. 1310-58-3)39

  • 24. Magnesiumcloride-oplossing (Cas-nr 7786-30-3)40

  • 25. Mangaandioxide

  • 26. Metaalschroten en draaisels die ontvet, gewassen en gedroogd zijn met deeltjes kleiner dan 10mm

  • 27. Mikrosilica (Cas-nr. 7631-86-9)41

  • 28. Motorengietïjzer, ontvet, gewassen en gedroogd

  • 29. Natriumhydroxide (natronloog) (Cas-nr. 1310-73-2)42

  • 30. Natriumperboraat-Tetrahydraat43

  • 31. Natnumsulfaat

  • 32. Ongebluste kalk CaO (Cas-nr. 1305-78-8); (mits gevolgd door een reiniging met water en reini- gingsmiddel)

  • 33. Puinglas

  • 34. Quartzpoeder

  • 35. Salpeterzuur44

  • 36. Siliciurndioxide

  • 37. Soda (NA2CO3)

  • 38. Steenstag

  • 39. Superalco (calciumhydroxide)45

  • 40. Tanco spodumene

  • 42. White spirit (kunstterpentijn)

  • 43. Zandcement

  • 44. Zinkoxyde (poeder en granulaat)

  • 45. Zinkpoeder

  • 46. Zout

  • 47. Zwavelzuur (Cas-nr. 7664-93-9)46

  • 1. Andere organische stoffen;

  • 2. Aceton (dimetylketon, propaan-2-on)47

  • 3. Antivries

  • 4. Azijnzuur48

  • 5. Benzyl

  • 6. Bijenwas (Cas-nr. 8012-86-3)49

  • 7. Butylacetyaat (n. sec-. ter-butylacetaat) (Cas-nr. 123-86-4,105-46-4, 540-88-5)50

  • 8. Bulyleenglyco51

  • 9. Calciumlignosulfonaat52

  • 10. Candelillawas (Cas-nr 8006-44-8)53

  • 11. Carnaubawas (Cas-nr 8015-86-9)54

  • 12. Cyclohexaan (hexamethyleen, hexanaffeen, hexahydrobenzeen) (Cas-nr. 110-82-7)55

  • 13. Cyclohexanol (hexahydrofenol) (Cas-nr. 108-93-0)56

  • 14. Dierlijke eiwitten57 (ingeval de volgende lading voedermiddelen betreft, niet aantoonbaar bestemd

    voor een productielijn voor niet-landbouwhuisdieren, of mengvoeders of voormengsels betreft, bestemd voor landbouwhuisdieren

  • 15. Dierlijke, margarine en plantaardige oliën en vetten (met uitzondering van cashewnotedopolie en reuwe tallolie)58

  • 16. Diervoeder met dierlijke eiwitten of geproduceerd op productielijnen met dierlijke eiwitten59 (ingeval volgende lading voedermiddelen betreft, niet aantoonbaar bestemd voor een productielijn voor niet-landbouwhuisdieren, of mengvoeders of voormengsels betreft, bestemd voor landbouwhuisdieren

  • 17. Ethylacetaat (zijnzure ethylester)(Cas-nr. 141-78-6)60

  • 18. 2-Ethylacetaat-1-ol(2-thylhexylalcohol)(Cas-nr. 104-76-7)

  • 19. Ferro-silicium

  • 20. Ferro-chrome

  • 21. G eepoxideerde sojaolie (minimaal 7% oxiraan-zuurstof)(Cas-nr. 8013-07-8)61

  • 22. Glycerol62

  • 23. Glycerine63

  • 24. Glycolen64

  • 25. Buttaandiol (1, 3-buthyleenglycol butaan- 1,3-dlol: 1, 4-buthyleenglycol, butaan-1, 4-diol;2,3-buthyleenclycol; butaan-2, 3-diol, buthyleenglycol)

  • 26. Polypropyleenglycol (molekuulgewicht hoger dan 400) (cas-nr. 25322-69-4)

  • 27. Propyleenglycol (1,2propyleenglycol; propaan - 1, 2-diol); 1, 2-hihydroxypropaan: monopropyleenglyhcol; methylglycol (Cas-nr. 57-55-6)

  • 28. 1, 3-Propyleenglycol (trimethyleenglycol; propaan-1,3-diol)

  • 29. n-heptaan65

  • 30. n-hexaan66

  • 31. Isopropanol67

  • 32. Kokkels

  • 33. Limoneen (dipenteen) (Cas-nr. 138-86-3)68

  • 34. Methanol (methylaclcohol) (Cas-nr. 67-56-1)69

  • 35. Methylethylketon (butanon) (Cas-nr. 78-93-3)70

  • 36. Methylisobuthylketon (4-methylpentaan-2-on)(Cas-nr. 108-10-1)71

  • 37. Methyl-tert-buthylether (MTBE) (Cas-nr. 1634-04-4)72

  • 38. Mierenzuur (methaanzuur, waterstofcarbonzuur)73

  • 38. Mosselen

  • 40. Natriumgluconaat

  • 41. Nonaan74

  • 42. Paraffine (mits van levensmiddelenkwaliteit)75

  • 43. Pentaan76

  • 44. N-propylacetaat77

  • 45. Propyleenglcol78

  • 46. Schuimaarde

  • 47. Vet-alcoholen79

  • 48. Buthylacohol (butaan-1-ol) (Cas-nr. 71-36-3)

  • 49. Hexylalcohol (hexaan-1-ol) (Cas-nr. 11-27-3)

  • 50. Heptylalcohol (heptaan-1-01) (Cas-nr. 110-70-6)

  • 51. Octylalcohol (octaan-1-o1) (Cas-nr. 111-87-5)

  • 52. Nonylalcohol (nonaan-1-ol)(Cas-nr. 143-08-8)

  • 53. Decylalochol (decaan-1ol) (Cas-nr. 112-301)

  • 54. Laurylacohol (dodeclylalcohol, dodecaan-1-ol) (Cas-nr. 112-53-8)

  • 55. Tridecylalchol (trodecaan-1-ol) (Cas-nr. 27458-92-0)

  • 56. Tetradecylalcohol (tetradecaan-1-ol) (Cas-nr. 112-72-1)

  • 57. Hexadecylalcohol (hexadecaan-1-ol, cetylalcohol) (Cas-nr. 36653-82-4)

  • 58. Octadecylalcohol (octadecaan-1-ol, stearylalchol) (Cas-nr. 112-95-5)

  • 59. Oleylalcohol (cls-octadec-9-enol) (Cas-nr. 143-28-2)

  • 60. Lauryl-myristylacolhol (mengsel C12/C14)

  • 61. Cetyl-stearylalcohol (mengsel C16/C18)

  • 62. Vetzuren80

  • 63. Boterzuur (n-boterzuur, butaanzuur, propaancarbonzuur) (Cas-nr: 107-92-6)

  • 64. Valeriaanzuur (n-pentaanzuur)(Cas-nr. 109-52-4)

  • 65. Capronzuur (n-hexaanzuur)(Cas-nr. 142-62-1)

  • 66. Heptaanzuur (n-heptaanzuur) (Cas-nr. 111-14-8)

  • 67. Caprylzuur (n-octaanzuur)(Cas-nr. 124-07-2)

  • 68. Pelargonzuur (n-nonaanzuur)(Cas-nr. 112-05-0)

  • 69. Caprinezuur (n-decaanzuur)(Cas-nr. 334-48-5)

  • 70. Laurinezuur (n-dodecaanzuur)(Cas-nr. 143-07-7)

  • 71. Lauroleinezuur (dodeceenzuur)(Cas-nr.4998-71-4)

  • 72. Myristinezuur (n-tetradecaanzuur)(Cas-nr. 544-63-8)

  • 73. Myristoleinezuur (tetradeceenzuur)(Cas-nr. 544-64-9)

  • 74. Palmitinezuur (n-hexadecaanzuur)(Cas-nr.57-10-3)

  • 75. Palmitoleinezuur (cis-hexadec-9-eenzuur)(Cas-nr. 373-49-9)

  • 76. Stearinezuur (n-octadecaanzuur)(Cas-nr. 57-11-4)

  • 77. Ricionolzuur (cis-12-hydroxyoctadec-9-eenzuur; castoroliezuur)(Cas-nr. 141-22-0) 83

  • 78. Oliezuur (n-octadeceenzuur)(Cas-nr. 112-80-1)

  • 79. Linolzuur (octadeca-9, 12-dieenzuur) (Cas-nr. 60-33-3)

  • 80. Linoleenzuur (octadeca-9, 12, 15-trieenzuur)(Cas-nr. 463-40-1)

  • 81. Arachidonzuur (icosaanzuur)(Cas-nr. 506-30-9)

  • 82. Berheenzuur (docosaanzuur)(Cas-nr. 112-85-6)

  • 83. Erucazuur (cis-docos-13-eenzuur)(Cas-nr. 112-86-7)

  • 84. Vetzuuresters81 (esters die ontstaan bij de reactie van een van bovengenoemde vetzuren met een van bovengenoemde veet alcoholen zoals butylmyristaat, oleylpalmitaat of cetylstearaat)

  • 85. Vetzuur-methylesters82

  • 86. Methyllauratt (methyldodecanaat) (Cas-nr. 111-82-0)

  • 87. Methylpalmitaat (methylhexadecanaat) (Cas-nr. 112-39-0)

  • 88. Methyistearaat (methyloctadecanaat) (Cas-nr 112-61-8)

  • 89. Methyloleaat (methyloctadecanaat) (Cas-nr. 112-62 9)

  • 90. Vinamul 3231 - latex (reinigingsregime c)

  • 91. Wljnmoer (vinasse, argol ruwe wijnsteen, ruwe kwatiumbitartraat)83

  • 92. Zure oliën en vetzuurdestitlaten (uit plantaardige oliën en vetten en/of mengsels darvan en dierlijke en mariene oliën en vetten)84

Categorie 4
Producten of grondstoffen voor humane voeding
Voedermiddelen voor de productie van mengvoeders of voor directe voedering
Meststoffen:
  • 1. Ammoniumsulfaat (GRAS)

  • 2. Diammoniumfosfaat (GRAS)

  • 3. Kaliumsulfaat (GRAS)

  • 4. Primair geproduceerde kalk

  • 5. Ureum (GRAS)

  • 8. Mengsels van de bovenbedoelde meststoffen

Producten m.b.t. grond:
  • 1. Grond van veenontgraving/zwartveen (van hoogveen-ontgraving)/ zwarte grond

  • 2. Tuinaarde/potgrond, bemest met kunstmeststoffen uit categorie 4

  • 3. Tuinturf

  • 4. Zand, niet verontreinigd of afkomstig van (voormalige) bedrijfsterreinen

Delfstoffen:
  • 1. Bruinkool

  • 2. Graniet

  • 3. Mijnsteen

  • 4. Quarts

  • 5. Steenkool, gewassen en ongewassen

Andere anorganische stoffen:
  • 1. Aluminiumsilicaat (Mullit) voor de keramische industrie (2AS2O3x 3SiO2)

  • 2. ArgexR

  • 3. Autobanden

  • 4 Calciumcarbonaat

  • 5. Calciumsilicaat/Casiflux F

  • 6. Gedemineraliseerd water

  • 7. Gravel

  • 8. Grind/kiezel

  • 9. Kalkslib, vrijkomend bij de melkzuurbereiding (CaCO3+ H2O)

  • 10. Keien

  • 11. Klinkers

  • 12. Kunststof

  • 13. Metaaldelen, mits deeltijesgrootte >10 mm en vetvrij/olievrij

  • 14. Metamix

  • 15. Metselcement, louter beslaande uit Portlandklinker Casnr. 65 997-15-1, anhydriet en/of dihydraat:

  • 16. Metselkalk, louter bestaande uit Portlandcementklinker en kalkhydraat.

  • 17. Natuurgips

  • 18. Nepheline syenïte

  • 19. Portlandcement, louter bestaande uit Portlandklinker Casnr. 65 997-15-1, kalksteen, gips en an hydriet

  • 20. Rode schiste

  • 21. Schelpen

  • 22. Split

  • 23. Talk

  • 24. Vermiculiet

Andere organische stoffen:
  • 1. Boomschors

  • 2. Diervoeder (droog of nat) zonder dierlijke eiwitten85

  • 3. Dierlijke eiwitten1, ingeval de volgende lading voedermiddelen betreft, aantoonbaar bestemd voor een productielijn voor niet-landbouwhuisdieren, of mengvoeders of voormengsets betreft, bestemd voor niet-landbouwhuisdieren

  • 4. Diervoeder met dierlijke eiwitten of geproduceerd op productielijnen met dierlijke eiwitten86, ingeval volgende lading voedermiddelen betreft, aantoonbaar bestemd voor een productielijn voor niet- landbouwhuisdieren, of mengvoeders of voosmengsels betreft, bestemd voor niet- landbouwhuisdieren

  • 5. Doordraai veilingen

  • 6. Ethanol (ethylalcohol) (Cas-nr. 64-17-5)

  • 7. Graszaad, mits van gezonde handelskwaliteit met het oog op diervoeding.

  • 8. Houtsnippers/groensnippers

  • 9. Boomschors

  • 10. (Oud) papier

5.3. Annex C: Procedure (her-)indeling producten in ladingcategorieën transport [Vervallen per 01-01-2006]

Producten en materialen die niet in Annex B in één van de ladingscategorieën 2,3 of 4 zijn opgenomen, zijn verboden als lading voor laadcompartimenten die voor diervoeders worden benut.

De ondernemer die een product ingedeeld of opnieuw ingedeeld wil hebben in één van de ladingcategorieën 2, 3, of 4, dient hiervoor een verzoek in te dienen bij het Productschap Diervoeder (PDV). De ondernemer dient bij de aanvraag gebruik te maken van het informatieformulier, aan het eind van deze annex.

De uitgangspunten van het College van deskundigen Diervoedersector (afdeling Transport) en het PDV m.b.t. besluitvorming n.a.v. het verzoek zullen gebaseerd worden op de volgende door de aanvragende onderneming aan te reiken parameters:

  • a. de door de ondernemer aangevraagde ladingcategorie;

  • b. het gangbare type vervoermiddel waarvoor de ondernemer de ladingcategorie aanvraagt;

  • c. de door de ondernemer gehanteerde reinigingsmethode;

  • d. het risico op residuwaardes/bestanddelen van het betreffende product na de door de ondernemer toegepaste reinigingsmethode;

De te volgen procedure luidt als volgt:

  • 1. De ondernemer stelt het informatieformulier (zie bijlage 1) op, met daarin (o.a.) aangegeven:

    • a. gehanteerde reinigingsmethode;

    • b. gangbaar type vervoermiddel;

    • c. Productsamenstelling (zo mogelijk vergezeld van een productfiche/veiligheidsinformatieblad met de volledige chemische analyse, inclusief onzuiverheden en verontreinigingen);

    • d. Monster van het betreffende product (ca. 500 gr.);

    • e. De eventuele bevindingen en analyse-uitslagen van uitgevoerde residubemonsteringen na reiniging.

  • 2. De ondernemer maakt een keuze:

    • a. Ondernemer dient het informatieformulier rechtstreeks in bij het PDV met het oog op mogelijke directe besluitvorming aan de hand van betreffende informatie en gelet op vergelijkbare producttypen;

    • b. Indien PDV niet o.b.v. advies van het College van Deskundigen Diervoedersector tot versnelde besluitvorming kan overgaan volgt hiervan bericht binnen 14 dagen na datum ontvangst;

    • c. Ondernemer laat eerst residubemonstering en -bepaling uitvoeren conform de procedure in Annex D en dient daarna het informatieformulier en bijbehorende zaken als bedoeld onder 1 in, inclusief analyse-certificaten residubepalingen;

  • 3. PDV informeert de ondernemer binnen 5 weken na ontvangst van volledig dossier over het indelingsadvies van het College van Deskundigen Diervoedersector, afdeling Transport.

    • a. Indien het dossier door PDV als niet volledig wordt beschouwd, ontvangt de ondernemer binnen 14 dagen hierover bericht (per e-mail, fax of brief);

    • b. Indien het College op basis van haar deskundigheid géén indelingsadvies n.a.v. het dossier kan geven, kan de ondernemer de procedure volgen als bedoeld onder 4;

    • c. Indien wél een indelingsadvies is geleverd, zie dan punt 5.

  • 4. Indien het College op basis van haar deskundigheid géén indelingsadvies n.a.l.v. het dossier kan geven, dan kan de ondernemer - voor eigen kosten - een deskundigeninstituut verzoeken om een adviesrapportage met onderbouwing (gebaseerd op een risicobeoordeling), waarin aangegeven wordt in welke ladingcategorie het product in kwestie kan worden ingedeeld. De ondernemer dient de informatie als bedoeld onder 2b) daarbij toe te zenden aan betreffend instituut.

  • 5. Het deskundigeninstituut dient de veiligheidsrisico's van het product te beoordelen voor diervoe ders (incl. voedermiddelen en andere diervoederproducten) die na betreffend product en na reiniging volgens de voorgeschreven reinigingsmethode in hetzelfde laadcompartiment getransporteerd worden. Het gaat hierbij zowel om veiligheidsrisico's voor dieren die de nadien getransporteerde voeders consumeren als voor de consument van de producten van betreffende dieren.

  • 6. Bij de advisering voor indeling in een ladingcategorie dient het deskundigeninstituut mede rekening te houden met de reinigings- en desinfectievoorschriften in annex A deze en de voorschriften voor de basisprincipes voor reiniging en desinfectie (vastgelegd in § 4.9.4 van de GMP-standaardwegtransport diervoedersector.

  • 7. De adviesrapportage van het deskundigeninstituut dient aan PDV te worden toegezonden, t.a.v. de secretaris van het College van Deskundigen Diervoedersector, afdeling Transport. PDV informeert de ondernemer binnen 3 weken na ontvangst van betreffende adviesrapportage of het College van deskundigen het betreffende indelingsadvies overneemt. Het PDV behoudt zich het recht voor de kennis voortvloeiend uit het deskundigenadvies aan te wenden voor de kennisopbouw van haar instituten, maar borgt de vertrouwelijkheid van het deskundigenadvies.

  • 8. De instituten welke geaccepteerd worden als adviserend instituut voor de productindeling in ladingcategorieën, zijn:

    • a. TNO Voeding, Zeist;

    • b. Rikilt, Wageningen;

    • c. Sterlab-geaccrediteerde instituten, die zich toeleggen op voedselveiligheidsonderzoeken.

      Het PDV zal voorts een uitnodiging sturen aan andere instituten met het verzoek of men - op grond van accreditatie, kennisniveau e.d. - wil toetreden tot de bovenbedoelde groep van deskundigeninstituten.

Wanneer het indelingsadvies van het College van deskundigen afwijkt van de door de ondernemer aangevraagde ladingcategorie, dan is de keus aan de ondernemer om hetzij akkoord te gaan met het indelingsadvies van het College dan wel zijn indelingsaanvraag in te trekken.

Informatieformulier her-/eerste* beoordeling productindeling ladingcategorieën [Vervallen per 01-01-2006]

Productsoort:

Huidige indeling Ladingcategorie:

Handelsnaam:

Productcode:

Verzoek dit product in te delen in ladingcategorie:

 

Gebruikelijk vervoermiddel voor dit product:

 

Gehanteerde Reinigingsmethode:

 

(Eventueel copie reinigingscertificaat bijgaand)

 

Producent:

 

Productsamenstelling (volledig - incl. eventuele onzuiverheden en verontreinigingen) (in %):

 

UN Code:

Productmonster + evt. Factsheet Producent bijleveren.

RESIDU monsters zijn samengesteld/verzameld door:

EN 45004 geaccrediteerd controlebedrijf (Fa naam vermelden) volgens bijgaand rapport.

Analyse op RESIDUE monsters werd verricht door (Naam lab)

Chemische bestanddelen /-analyse:

(Sterlab analyse)(incl. onzuiverheden /verontreinigingen)

Fysische /chemische eigenschappen

Toxicologische eigenschappen en andere typen risico's (carcinogeniciteit, mutageniteit, etc.)

Microbiologische en pathogene eigenschappen(bij producten met organische bestanddelen)

Bij microbiologische gevoeligheid dient een analyse op salmonella, clostridia en biogene aminen plaats te vinden. Volgens bijgaand analysecertificaat No:

van:

Toepassingsbereik /doel product87 :

0 food grade

0 feed grade (gezonde handelskwaliteit)

0 anders, n.l

Gegevens adviesaanvrager

Aantal bijlagen:

Naam:

Adres en plaatsTelefoonnummer:

Plaats,

Datum

5.4. Annex D: Residubemonstering en -bepaling laadruimten na transport producten, waarvoor een (her)indeling in ladingcategorieën wordt verzocht (wegtransport) [Vervallen per 01-01-2006]

In het kader van de procedure (her) indeling producten in ladingcategorieën transport kunnen controlerende instanties uitgenodigd worden door GMP gecertificeerde vervoersondernemers de noodzakelijke verrichtingen uit te voeren m.b.t. het nemen van monstermateriaal aangaande de nadere bepaling van residuverontreiniging, dan wel de afwezigheid daarvan.

De werkzaamheden aangaande deze bemonstering dienen uitgevoerd te worden door EN 45004 geaccrediteerde inspectieorganisatie, waarbij het keuren van laadruimte behoort tot de geaccrediteerde verrichtingen.

De transportondernemer die de residubemonstering aanvraagt, dient te voldoen aan de volgende bijkomende voorwaarden:

  • a. de aanvragende transportonderneming voorziet de aanvraag voor de bemonstering van de ledige en gereinigde laadruimte van een garantie, dat de laadruimte valt onder het kwaliteitssysteem inzake de GMP-standaard wegtransport diervoedersector;

  • b. de aanvragende transportonderneming voorziet de aanvraag voor bemonstering van de laadruimte van een lijst met de 10 voorafgaand aan de keuring in betreffende laadruimte vervoerde ladingen (Deze lijst is getekend en gedagtekend door de kwaliteitsmanager van de transportonderneming);

  • c. de aanvragende transportonderneming voorziet de aanvraag voor keuring van de laadruimte van een lijst met uitgevoerde reinigingen en desinfecties na de 5 voorafgaand aan de keuring vervoerde ladingen met de betreffende laadruimte;

  • d. de aanvragende transportonderneming verklaart zich bij voorbaat bereid tot het verstrekken van nadere inlichtingen met betrekking tot de aard en eigenschappen van de voorafgaand aan de keuring vervoerde ladingen.

De controlebedrijven zullen na uitvoering van de bemonstering een bemonsteringsrapport afgeven, waarop aan de kwaliteitsmanager van de transportonderneming wordt medegedeeld, dat er op basis van de visuele inspectie ten tijde van de laadruimte bemonstering, dat op (datum en tijd) de laadruimte visueel geschikt bevonden werd voor het transport van diervoeders, onder voorbehoud van nadereonderzoeken m.b.t. de mogelijke residuverontreiniging, met inachtneming van het bepaalde van de regels voor transport in het kader van deze GMP-standaard wegtransport diervoedersector.

De bemonstering wordt doorgevoerd conform het principe van een "at random" verzamelen van ladingresiduen. Daarbij wordt gebruik gemaakt van bestaande technieken (Afdrukplaatjes, Swabs, Wallwash monsters(steriele veegdoekjes of sponsjes). Daarnaast dient bij de random selectie van de te bemonsteren plaatsen rekening gehouden te worden met de kritische contactpunten in een laadcompartiment:

  • a. openingen en doorvoerpunten

  • b. constructie oneffenheden/verbindingen

  • c. onderscheid maken tussen lage en hoge contactpunten

  • d. afdekmateriaal/kleppen/deksel/scharnierpunten/versterkingen.

De controlebedrijven verzamelen op minimaal 8 verschillende contactpunten een ladingresidumonster. Elk ladingresidumonster krijgt een referentie, waarmee verwezen wordt naar het contactpunt dat bemonsterd is, deze informatie wordt tevens vastgelegd in het bemonsteringsrapport..

De residumonsters worden door het controlebedrijf op de juiste wijze verpakt, van een identificatiezegel voorzien en ter beschikking van de ondernemer gesteld. De verpakking en het identificatiezegel worden in het bemonsteringsrapport vastgelegd.

Vertegenwoordigers van de vervoerders van Agribulk worden uitgenodigd een inventarisatie te maken van potentieel beschikbare controlebedrijven.

De transportondernemer zendt de residumonsters - tesamen met een monster van het originele product - voor analyse/bepaling aan een ingevolge ISO 17025 geaccrediteerd of ingevolge de GMP-standaard laboratoria bedrijfsinterne controle diervoedersector gecertificeerd laboratorium voor betreffende bepalingen en producten, met het verzoek om te bepalen óf er residuen aanwezig zijn en zo ja in welke concentraties.

5.5. Annex E: Procedure voor toelating laadruimtes na transport van verboden ladingen [Vervallen per 01-01-2006]

Wanneer in een laadcompartiment een verboden lading is getransporteerd dan kan het transportmiddel /de laadruimte in bepaalde gevallen, onder de onderstaande stringente voorwaarden alsnog (weer) worden gecertificeerd/vrijgegeven voor het transport van diervoeders.

Na verboden ladingen kan een transportmiddel/laadruimte volgens de volgende procedure worden vrijgegeven om er weer diervoeders in te transporteren:

  • a. een op de aard van de verboden lading toegesneden reiniging met water (en

  • b. reinigingsmiddel) en desinfectie, uitgevoerd volgens een vooraf door de ondernemer uitgewerkt protocol;

  • c. beoordeling - voor rekening van de ondernemer - door een door het productschap aangewezen controlerende instantie van de laadruimte na bovenbedoelde reiniging en desinfectie;

De controlerende instantie gaat hierbij aan de hand van het logboek na welke voorafgaande ladingen zijn getransporteerd en welke reinigingen en desinfecties zijn uitgevoerd. De laadruimte van het transportmiddel wordt vervolgens visueel beoordeeld op eventueel aanwezige resten, met name op moeilijk reinigbare plaatsen.

Afhankelijk van de voorgaande ladingen en de resultaten van de visuele inspectie kunnen, ter beoordeling van de controlerende instantie - voor rekening van de ondernemer - aanvullende hygiënemetingen worden verricht met behulp van ATP-metingen of agarstempels;

  • -

    afgifte door de controlerende instantie van een certificaat, waaruit moet blijken of het transportmiddel /de laadruimte weer kan worden vrijgegeven voor transport van diervoeders.

5.6. Annex F: Protocollen i.r.t. het transport van stapelbare pluimvee- en paardenmest [Vervallen per 01-01-2006]

Branche: mestvervoer Toepassing: vervoermiddelen voor vaste mest [logo en naam bedrijf]

Procedures GMP Handboek

Protocol reinigen en ontsmetten

Document nr.:

HYGIENE

Pagina nr.: /

Akkoord:

Versiedatum: 7 juni 2001

Strekking

Dit protocol is bedoeld voor chauffeurs. Er staat hoe het reinigen en ontsmetten uitgevoerd moet worden.

Protocol reinigen en ontsmetten [Vervallen per 01-01-2006]

Algemeen [Vervallen per 01-01-2006]

  • 1. Is het langer dan een half jaar geleden dat de reinigings- en ontsmettingsinstallatie op je auto is gekalibreerd? Zo ja meld dat dan aan [naam medewerker].

  • 2. Heeft je werkgever je de benodigde beschermingsmiddelen verstrekt die nodig zijn bij werken met ontsmettingsmiddel?

Het reinigen [Vervallen per 01-01-2006]

Voordat ontsmet kan worden moet de auto grondig gereinigd zijn.

  • 1. Zet de wagen op een helling of in een lichte kiepstand, zodat het waswater goed wegloopt.

  • 2. Reinig de buitenkant éérst en daarna de binnenkant, zeker als er mest aan de buitenwanden zit. Anders spuit je de mest van de buitenwand weer terug in de bak, vooral als het dekzeil van de bovenkant opgerold is.

  • 3. Werk bij het reinigen van boven naar beneden. Let speciaal op deze kritische punten: de flap, de stortopening en de graanschuif, het dekzeil (uitrollen!), het kopschot en het achterschot (de kieren, naden en rubbers van de deur).

  • 4. Als de wagen op het oog schoon is, ga je met de spuit helemaal naar achteren. Loop dan met de spuit voor je uit en "veeg" je met de spuit de wanden en vloer schoon. Op deze manier haal je de laatste vuildeeltjes weg. Zorg wel dat je laarzen goed schoon zijn voordat je hiermee begint!

  • 5. Vergeet het dekzeil niet uit te rollen en te reinigen.

  • 6. Kijk naar de kritische punten bij het reinigen. Na het reinigen: zie de "Checklist controle op reini gen en ontsmetten door chauffeurs"

Het ontsmetten [Vervallen per 01-01-2006]

Na controle op een grondige reiniging moeten alle oppervlakken ontsmet worden om bacteriën en virussen af te doden.

  • 1. Verwijder overtollig water op de vloer met een trekker.

  • 2. Ga met schone laarzen in het laadruim om te ontsmetten.

  • 3. Laat de spuit lopen totdat je ziet dat er ontsmettingsmiddel uit komt (het schuimt dan een beetje of je kunt het ruiken).

  • 4. Ontsmettingsmiddel met lage druk en grove druppel verspuiten. Niet sterk vernevelen.

  • 5. Ontsmet de vloer en wanden. Vergeet de buitenkant niet.

  • 6. Zorg dat je genoeg ontsmettingsmiddel gebruikt voor een goede afdoding van bacterin en vi russen. Hoe dit werkt hangt af van de gebruikte ontsmettingsapparatuur. De richtlijnen hiervoor krijg je van je bedrijf. Zie hiervoor de "Procedure onderhoud en kalibratie".

  • 7. Pas op bij ontsmetten met windvlagen; het middel kan ingeademd worden of in de ogen terecht komen.

  • 8. Na ontsmetten naspoelen met water.

Opmerkingen.

Opmerkingen over onderhoud en niet goed werkende apparatuur doorgeven aan [naam medewerker]. Opmerkingen over dit protocol doorgeven aan [naam medewerker].

Branche: mestvervoer Toepassing: vervoermiddelen voor vaste mest

Procedures GMP Handboek

Controle op reinigen en ontsmetten door chauffeurs

Document nr.:

HYGIENE

Pagina nr.: /

Akkoord:

Versiedatum: 7 juni 2001

Strekking

Deze checklist is bedoeld voor chauffeurs, om te controleren of de reiniging en ontsmetting goed is verlopen.

Controle door de chauffeur: [Vervallen per 01-01-2006]

Na het reinigen: [Vervallen per 01-01-2006]

Alle auto's:

  • 1. Denk ook aan het reinigen van treeplanken, pedalen, laarzen

  • 2. Leg géén vuile overalls en vuile laarzen in de cabine Kipper:

Kipper:

  • 1. Let op de boven- en onderkant van de stangen en de steunpunten van de stangen

  • 2. Let op de opstapjes in de bak, vooral aan de onderkant

  • 3. Let op de scharnieren van de deuren en de deurkieren

  • 4. Let op de graanschuif/stortopening en de kieren daarin

  • 5. Let op de rubbers van de deuren

  • 6. Let op de hele deuropening

  • 7. Let op de bovenkant van de laadbak

  • 8. Let op de onderzijde van het dekzeil

  • 9. Let op de zijkanten van de laadbak en de bovenkant van het dekzeil

Walking Floor:

  • 1. Let op naden in de vloer

  • 2. Let op achterschot en flap

  • 3. Let op achter het schot

  • 4. Let op de punten die ook bij kipper genoemd zijn

  • 5. Let op de onderzijde van het dekzeil

  • 6. Let op de zijkanten van de laadbak en de bovenkant van het dekzeil

Container:

  • 1. Let op de scharnieren van de deuren en de deurkieren

  • 2. Let op de bovenrand van de laadbak

Na het ontsmetten [Vervallen per 01-01-2006]

  • 1. is overal ontsmet: wanden binnenkant, vloer, wanden buitenkant?

  • 2. is er ontsmettingsvloeistof uit de voorraadbus gelopen?

Administratie: [Vervallen per 01-01-2006]

  • 1. Vul op de [naam document] in, met welke methode er is gereinigd.

  • 2. Zorg ervoor dat de vrachtauto droog is voordat u opnieuw gaat laden.

  • 3. Na controle en het laten invullen van de reinigingsverklaring kunt u laden.

Branche: mestvervoer

Procedures GMP Handboek

Document nr.:

Akkoord:

Toepassing: vervoermiddelen

Onderhoud en kalibratie

HYGIËNE

 

voor vaste mest

[logo en naam bedrijf]

Versiedatum: 19 februari 2001

Pagina nr.: /

1. Proceseigenaar. [Vervallen per 01-01-2006]

De directie is verantwoordelijk voor de aanschaf van nieuwe hygiëne apparatuur en meetmidden. De directie is verantwoordelijk het vaststellen van de onderhoudscontracten.

[naam medewerker] is verantwoordelijk voor de onderhoudsplanning, uitvoering en registratie van het onderhoud en kalibratie van hygiëne apparatuur.

2. Strekking. [Vervallen per 01-01-2006]

Deze procedure beschrijft hoe onderhoud van machines en kalibratie van meetmiddelen op het bedrijf geregeld zijn. Doel is het voorkomen van storingen en afwijkingen van hygiëne apparatuur die kunnen leiden tot risico's m.b.t. hygiëne of voortgang van het transport.

3. Referenties. [Vervallen per 01-01-2006]

  • a. GMP Transportregeling

  • b. Onderhouds- en kalibratieplanning

  • c. Invullijst kalibratie

4. Procesbeschrijving [Vervallen per 01-01-2006]

4.1. Preventie [Vervallen per 01-01-2006]

De bij het reinigen en ontsmetten te gebruiken apparatuur wordt preventief onderhouden en gekalibreerd volgens onderstaande onderhouds- en kalibratieplanning:

Wat onderhouden / kalibreren?

Frequentie

Hoe controle

Kalibratie van de spuitapparatuur op de auto

2x per jaar en na een reparatie of vervanging

zie invullijst kalibratie

Kalibratie van de doseer installatie voor desinfectania

2x per jaar en na een reparatie of vervanging

zie invullijst kalibratie

  • -

    Alle installaties op vrachtwagens worden genummerd met een nummer dat overeenkomt met het nummer op de Invullijst kalibratie.

  • -

    [naam medewerker] legt de uitgevoerde kalibratie steeds vast op de Invullijst kalibratie.

  • -

    Indien onderhoud of kalibratie niet zelf wordt uitgevoerd, wordt de Invullijst kalibratie ingevuld door/naam medewerker] en tevens de kopie van de bon en/ of factuur achter de Invullijst kalibratie bewaard en het order/ factuurnr vermeld op de Invullijst kalibratie.

4.2. Storingen verhelpen [Vervallen per 01-01-2006]

Alle medewerkers melden belangrijke storingen direct aan [naam medewerker]. Storingen worden in eerste instantie zoveel mogelijk door [naam medewerker] zelf opgelost. Indien reparaties niet zelf opgelost kunnen worden neemt [naam medewerker] contact op met de firma die het onderhoud verricht of die de apparatuur heeft geleverd. Hij zorgt ervoor dat het uitgevoerde storingsonderhoud steeds vastgelegd wordt op de onderhoudsplanning.

4.3. Evaluatie [Vervallen per 01-01-2006]

In een werkoverleg evalueert de directie met de [naam medewerker) het uitgevoerde onderhoud en kalibratie. De directie probeert achterliggende oorzaken te achterhalen van machines met teveel storingen. Vervolgens zoekt de directie maatregelen ter verbetering. Eventuele verbeterpunten in preventief onderhoud of kalibratie worden aangepast in deze procedure of in de bijbehorende Invullijst kalibratie.

Branche: mestvervoer Toepassing: vervoermiddelenvoor vaste mest

Procedures GMP Handboek

Invullijst kalibratie

Document nr.:

HYGIËNE

Pagina nr.: /

Akkoord:

Versiedatum: 19 februari 2001

Naam medewerker

Datum controle

Kenteken en nr installatie

1. Controle spuit

2. Controle dosering desinfectiemiddel

Opmerkingen

 

1.1 Druk (bar)

1.2 Liter per minuut van de spuitlans

2.1 Liter per minuut van de desinfectiespuit

2.2 Dosering van het ontsmettingsmiddel

 

1e

2e

gemiddeld

1e

2e

gemiddeld

1e ml

2e ml

gemiddeld %

 
                       
                       
                       

Controle spuit

  • Meet de druk van de spuit door een nanometer op de spuitkop van de installatie te monteren. Noteer in vak 1.1

  • De nanometer is gemonteerd op een T-stuk met een spuitkop opening van .. bij.. mm.

  • Gebruik een oliegevulde nanometer (bar) met DIN 16007 norm

  • Meet de wateropbrengst van de spuit.

  • Houd de spuitlans met originele spuitkop in een lege jerrycan en laat de spuit 3 minuten lopen.

  • Weeg de jerrycan en noteer in bovenstaande tabel in vak 1.2: gewicht gedeeld door 3. Maak de jerrycan weer leeg.

  • Voer bovenstaande twee punten tweemaal na elkaar uit.

  • Noteer het gemiddeld gewicht van de twee metingen in liters per minuut in vak 1.2 bij "gemiddeld".

Controle dosering desinfectiemiddel

  • Meet de wateropbrengst van de desinfectiespuit.

  • Zie links bij onderdeel "B". Noteer de uitkomsten in bovenstaande tabel in vak 2.1.

  • Meet de dosering ontsmettingsmiddel. Alléén bij een aanzuig- of venturisysteem:

    • Zet de aanzuigslang in een maatbeker met water. De maatbeker moet goed afleesbare maatstreepjes hebben.

    • Houd de spuitlans met originele spuitkop in een lege jerrycan en laat de spuit 5 minuten lopen. Noteer in bovenstaande tabel bij vak 2.2 hoeveel ml water die uit de maatbeker is gegaan.

    • Voer bovenstaande twee punten tweemaal na elkaar uit.

    • Bereken nu de dosering ontsmettingsmiddel: het gemiddeld aantal ml water dat uit de maatbeker is gegaan gedeeld door het aantal liter per minuut van de desinfectiespuit (zie vak 2.1). Deel deze uitkomst door 10 en noteer dit in vak 2.2. bij "gemiddeld".

08. GMP-standaard zeescheepvaart-, binnenvaart- en rail- vervoer diervoedersector GMP08 ; 11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 3
4 Kwaliteitssysteemeisen 3
 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

3

    4.6.1 Algemeen 3
    4.6.2 Procedure voor het aanbesteden van het transport 4
    4.6.3 Opdrachtverstrekking ter bevrachting 4
 

4.7

Beheersing van door de Afnemer verstrekte Producten

6

 

4.8

Identificatie en Naspeurbaarheid van Producten

6

    4.8.1 Opdrachtverstrekking voor de Inspectie van de Lading Compartimenten 6
    4.8.2 Opdrachtverstrekking ter uitvoering van LCI 6
    4.8.3 Rapport van de bevindingen tijdens de Inspectie van de Lading Compartimenten 7
 

4.9

Procesbeheersing

5

 

4.10

Keuring en Beproeving

8

 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

8

 

4.12

Keurings- en Beproevingsstatus

8

 

4.13

Beheersing van Producten met Afwijkingen

8

 

4.14

Corrigerende en preventieve Maatregelen

8

 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

8

 

4.16

Beheersing van Kwaliteitsregistraties

8

 

4.17

Interne Kwaliteitsaudits

8

 

4.18

Opleiding

8

 

4.19

Nazorg

8

 

4.20

Statstische Technieken

8

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling op de algemene GMP-standaard diervoedersector (GMP01) voor ondernemers (leveranciers of ontvangers) die opdracht nemen voor of geven tot het transport van voedermiddelen, voormengsels, diervoeders en toevoegingsmiddelen, dat niet over de weg plaatsvindt.

De algemene GMP-standaard diervoedersector (GMP01) is integraal van toepassing, voor zover van toepassing

Indien de ondernemer verrichtingen uitvoert waarvoor een aanvullende GMP-standaard bestaat (b.v. op- & overslag, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

Vanwege de verschillen in de structuur en karakter van de verschillende vormen van vervoer is besloten een opsplitsing te maken in de standaarden voor de volgende vormen van transport:

  • 1. Wegvervoer (GMP07)

  • 2. Zeescheepvaart, binnenvaart en railvervoer (GMP08)

Hieronder volgen de bepalingen m.b.t. vorm

B.: Zeescheepvaart, binnenvaart en railvervoer

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

Naast de termen en definities als bedoeld in de algemene standaard, zijn in het kader van deze aanvulling de volgende definities van toepassing:

LCI

Laad Compartimenten Inspectie

Verwerver

Is de koper van veevoedergrondstoffen

Leverancier

Is de leverancier van veevoedergrondstoffen

Bevrachtende

Opdrachtgever van het

partij

transport

Vervrachter

Aanbiedende partij van vervoersmodaliteit

Agri-Only

Aanduiding van een transportmiddel dat gedurende een periode van tenminste 6 maanden ononderbroken deelgenomen heeft aan het transport van uitsluitend veevoeder en/of voedingsmiddelengrondstoffen van plantaardige afkomst.

4. Kwaliteitssysteem eisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kaliteitssysteem [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

-

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

Specifieke documenten die in het kader van het kwaliteitssysteem beheerd en geadministreerd moeten worden zijn de bevrachting- overeenkomsten de opdrachtverstrekkingen tot LCI en de van de ingeschakelde controle-organisaties ontvangen LCI-rapportages.

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Algemeen [Vervallen per 01-01-2006]

De ondernemer die de opdracht verstrekt voor het transport dient over procedures te beschikken, die afdoende borging bieden ten aanzien van:

  • a. Voorkennis ten aanzien van de vorige ladingen88,

  • b. Preselectie van het transportmiddel op basis van het voorgaande ladingen record met inachtneming van de wettelijke en/of contractuele bepalingen met betrekking tot het product en het vervoer van dit product89.

  • c. Daar waar geen wettelijke bepalingen gelden, dienen bedrijven voor het vervoer van vloeibare agri-bulk (tanktransport), criteria ten aanzien van voorgaande ladingen vast te leggen in kwaliteitsprocedures- en handboek, op basis van de HACCP-systematiek.

  • d. De HACCP systematiek omvat: Analyseren van de potentiële risico's voor diervoeder- en voedselveiligheid als gevolg van contaminatie vanuit de laadruimtes;

  • e. Nagaan op welke punten zich risico's voor diervoeder- en voedselveiligheid kunnen voordoen;

  • f. Besluiten, welke van de geïdentificeerde punten kritisch zijn voor de diervoeder- en voedselveiligheid, de "kritische punten";

  • g. Omschrijven en ten uitvoer brengen van doeltreffende controle- en bewakingsprocedures op die kritische punten;

  • h. Op gezette tijden, en telkens wanneer de handelingen in het bedrijfsproces worden gewijzigd, het opnieuw bezien van de analyse van de risico's voor diervoeder- en voedselveiligheid, de kritische controlepunten en de controle- en bewakingsprocedures.

  • i. Acceptatie door de scheeps-/ wagoneigenaar / vervrachter, via de transportovereenkomst, van een LCI-clausule, waarmee hij zich mede onderwerpt aan een LCI door eventueel een (gecertificeerde) inspectie-organisatie90

  • j. Instructieverstrekking aan een inspectie- organisatie over te gaan tot een LCI

  • k. Het slechts beladen van het transportmiddel nadat vanuit de LCI-rapportage gebleken is, dat het transportmiddel voldoet aan de zuiverheidscriteria in 4.3;

  • I. Bewaking van de belading van het transportmiddel op het gebied van Feed Safety door een (GMP-)gecertificeerde inspectie-organisatie91, als borging van de inlaadcontrole.

De ondernemer die de opdracht verstrekt voor het transport en een controle-organisatie inschakelt voor de Lading Compartimenten Inspectie (LCI) en voor de bewaking van de belading van het transportmiddel op het gebied van Feed Safety, dient hierbij te kiezen voor een (GMP-)gecertificeerd internationaal opererend controlebedrijf, op het niveau van EN 45000 met specialisatie op veevoeders/granen of vloeibare agri-bulk in de accreditatie en internationaal opererend op een gecertificeerd borgingssysteem zoals ISO 9000 of equivalent.

Het productschap is gerechtigd de namen te publiceren van de controle-organisaties die voldoen aan de voorwaarden als hiervoor bedoeld.

4.6.2. Procedure voor het aanbesteden van het transport [Vervallen per 01-01-2006]

De ondernemer die de opdracht verstrekt voor het transport dient de onderstaande voorwaarden te realiseren in zijn relatie met de vervrachter.

4.6.3. Opdrachtverstrekking ter bevrachting [Vervallen per 01-01-2006]

4.6.3.1. Doelstelling [Vervallen per 01-01-2006]

Een transportmiddel te (doen) bevrachten waarvan kan worden aangenomen, dat het geschikt is om een lading Graan / Veevoedergrondstof te vervoeren van de laadplaats naar de losplaats in het kader van het streven naar Feed Safety. Deze doelstelling bereikt men door reeds bij de opdrachtverstrekking basiseisen aan het transportmiddel te stellen, die een goede onderbouwing van de Food/Feed Safety bevorderen.

4.6.3.2. Opdrachtverstrekking [Vervallen per 01-01-2006]

Een opdrachtverstrekking "Bevrachting" dient minimaal de volgende elementen te bevatten, die door de tegenpartij(vervrachter) onderschreven moeten worden bij het aangaan van de transport offerte en uiteindelijk bevestigd dienen te worden in de transportovereenkomst:

  • Ladingscompartimenten zuiverheidclausule:

    waarin de vervrachter garandeert, dat een schoon, ledig, droog en reukloos, ladingscompartiment wordt geleverd, dat in alle opzichten geschikt is voor de belading met en het vervoer van de te bevrachten goederen

  • De vervrachter moet de aard / benaming van de voorgaande ladingen van het betreffende transportmiddel of van (de)het betreffende ladingscompartiment-(en) opgeven bij de benoeming van het transportmiddel, alsmede indien bekend de laatste schoonmaakactiviteit van het (de) ladingscompartiment(en), zodra het schip gereed gemeld wordt voor de LCI.

    Zeevaart:

    4 voorgaande ladingen92

    Binnenvaart

    3 voorgaande ladingen & eventueel Agri-Only93

    Railvervoer

    2 voorgaande ladingen & eventueel Agri-Only

  • Ladingcompartimenten Inspectie clausule:

    waarin de bevrachter het recht reserveert de ladingscompartimenten te inspecteren voor de acceptatie van het transportmiddel en de vervrachter zich verbindt tot de bevindingen tijdens de inspectie en bij een ingebrekestelling aangaande de geschiktheid van de ladingscompartimenten onmiddellijk overgaat tot het nemen van de noodzakelijke maatregelen voor rekening van het transportmiddel om de Ladings-compartimenten geschikt te maken voor belading en het transportmiddel zo snel mogelijk opnieuw aan te bieden voor een herinspectie van de Ladingscompartimenten.

  • Een duidelijke goederenomschrijving: aard, soort.

4.6.3.3. Vastleggen van de bevrachting [Vervallen per 01-01-2006]

Doelstelling [Vervallen per 01-01-2006]

De bevrachting van een transportmiddel op een dergelijke manier vastleggen, opdat de informatie, die relevant is voor de Feed Safety in de bevrachtingovereenkomst wordt vastgelegd.

Een registratie "Bevrachting" dient minimaal de volgende elementen te bevatten, die door de tegenpartij(vervrachter) onderschreven moeten worden bij het aangaan van de transportofferte en uiteindelijk bevestigd dienen te worden in de transportovereenkomst:

  • 1. Naam en aard transportmiddel, nummer(s)

  • 2. Aard en aantal laadcompartimenten bestemd voor de te vervoeren lading

  • 3. De partij

  • 4. Goederenomschrijving

  • 5. Hoeveelheid

Ladingcompartimenten zuiverheidclausule: [Vervallen per 01-01-2006]

waarin de vervrachter garandeert, dat een alle opzichten schoon, ledig, droog, reukloos ladingscompartiment wordt geleverd, dat in alle opzichten geschikt is voor belading met en het vervoer van de partij.

De aard / benaming van voorgaande ladingen [Vervallen per 01-01-2006]

van het betreffende transportmiddel of de betreffende laadcompartimenten bij de benoeming van het transportmiddel, alsmede indien bekend bij de benoeming van het transportmiddel de omschrijving van de laatste schoonmaakactiviteit van het (de) ladingscompartiment(en).

Voorgaande lading

4

3

2

1

4.6.3.4. Ladingcompartimenten Inspectie clausule [Vervallen per 01-01-2006]

De LCI wordt uitgevoerd door: ( Naam inspectieorganisatie) [Vervallen per 01-01-2006]

Indien een transportmiddel door de vervrachter wordt opgegeven, dat gedurende minimaal 6 maanden alleen Agri bulk94 heeft vervoerd, dan dient dit vermeld te worden als volgt:

Type Transportmiddel: Agri-Only

Buiten de hierboven genoemde clausules worden uiteraard nog de typisch tot een bevrachting behorende clausules toegevoegd.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

De ondernemer die de opdracht verstrekt voor het transport dient het volgende te realiseren in relatie tot de laadcompartimenteninspectie (LCI).

4.8.1. Opdrachtverstrekking voor de Inspectie van de Lading Compartimenten [Vervallen per 01-01-2006]

4.8.1.1. Doelstelling [Vervallen per 01-01-2006]

Een controleorganisatie voor de uitvoering van een "Laad Compartimenten Inspectie in het kader van GMP Feed Safety" op een juiste en heldere wijze de benodigde informatie te verstrekken. De verstrekte informatie dient zodanig omschreven te zijn, darde controleorganisatie in staat gesteld wordt de LCI correct uit te voeren, noodzakelijke voorzorgen en maatregelen te nemen en op juiste wijze de bevindingen van de LCI aan zijn opdrachtgever te rapporteren.

4.8.1.2. LCI opdrachtverstrekking [Vervallen per 01-01-2006]

Een opdrachtverstrekking "LCI-GMP" dient minimaal de volgende elementen te bevatten, die bij aanvaarding van de opdracht door de ladingsinspecteur bevestigd moeten worden:

  • a. De opdracht betreft een LCI-GMP Feed Safety

  • b. De partij(en) {goederenomschrijving(en) en hoeveelhe(i)d(en)}

  • c. Aard / Naam / Nummer(s) van het(de) transportmiddel(len) Eventuele toevoegingen: Eigenaar

  • d. Type Transportmiddel: Agri-Only of Algemeen

  • e. Aantal, nummer, aanduiding van (het)de ladingscompartiment(en)95 voorzien voor de partij, indien van toepassing aanwijzingen ten aanzien van:

    • Deellading / Deelstuwage

    • Gescheiden stuwage / Samenlading

  • f. Voorgaande ladingen

Voorgaande lading

4

3

2

1

Rapportage van de bevindingen van de LCI dient direct na voltooiing aan de opdrachtgever kenbaar gemaakt te worden.

Daarnaast dient een LCI opdrachtverstrekking de standaardinformatie te bevatten, die een ladingsinspecteur in staat stellen de opdracht uit te voeren, zoals voorziene datum, laadplaats, de leverancier, de eigenaar van het transportmiddel, de bestemming van de partij (deze informatie is echter vanzelfsprekend en heeft geen betrekking op de borging van de Feed Safety).

Een LCI opdrachtverstrekking mag onderdeel zijn van een totaal opdrachtenpakket, maar dient wel als zodanig vermeld te worden. Eventuele met bijkomende informatie aangaande de partij en specifieke informatie aangaande het transportmiddel.

4.8.2. Opdrachtverwerking ter uitvoering van LCI [Vervallen per 01-01-2006]

Doelstelling [Vervallen per 01-01-2006]

De uitvoering van een Laad Compartimenten Inspectie door Controleorganisaties op een zodanige wijze te doen opzetten, dat een LCI geborgd wordt waarbij de Feed Safety optimaal nagestreefd wordt.

Procedures [Vervallen per 01-01-2006]

Procedures ontwerpen die door de controleorganisaties worden verwerkt tot werkinstructies voor de verrichting van de LCI. Deze dienen voldoende borging te bieden ten aanzien van de controle op de uitvoering van de instructies en de doelstelling van de LCI, alsmede de rapportage en daar waar van toepassing zowel nationaal als internationaal.

De procedures en de daaruit voortvloeiende instructiehandboeken, waarover de controleorganisaties dienen te beschikken in een kwaliteitssysteem, dat voldoet aan de EN 45000 Norm - met specialisatie op veevoeders/ granen of vloeibare agri-bulk in de accreditatie - en internationaal opererend op een gecertificeerd borgingssysteem zoals ISO 9000 of equivalent (met evt. incorporatie van het HACCP-principe) dienen minimaal de volgende criteria te omvatten:

  • 1. Borging visuele beoordeling van lading-compartimenten op geschiktheid voor de opslag of het vervoer van de te beladen Agri-bulk goederen.

  • 2. De geschiktheid dient o.m. getoetst te worden op de volgende punten:

    • a. Schoon, Ledig, Droog, Reukloos

    • b. De afwezigheid van mogelijk Agri-bulk onvriendelijke elementen, zoals resten van voorgaande ladingen en/of reinigingsactiviteiten.

    • c. De afwezigheid van ongedierte in de breedste zin van het woord .{insectenen ongedierte (dood of levend)}

    • d. Sluitbaar en Heel. Er dient visueel getoetst te worden of het transportmiddel de te vervoeren goederen voldoende beschermt tegen invloeden van andere te vervoeren goederen en voorts of het is voorzien van middelen waarmee de lading tijdens het laden en de reis kan worden afgedekt. Hiermee wordt geen nautische controle of controle van de technische staat bedoeld, maar een visuele beoordeling van de situatie.

    • e. In de uitwerking van de toetsing dienen duidelijke ter zake deskundige instructies gegeven te worden voor de meerdere aandachtspunten, met specifieke verwijzingen per type transportmiddel.

    • f. Hoe te handelen bij afwijkende vaststellingen (Non-conformiteit).

    • g. Vastlegging bevindingen.

    • h. Rapportage naar opdrachtgever.

    • i. Internationale LCI opdrachten uitgevoerd door of in opdracht van de Nederlandse vestiging van internationaal opererende controlebedrijven, dienen volgens dezelfde kwalitatieve maatstaven te worden verricht, als die waarop de toetsing heeft plaatsgevonden bij de gecertificeerde Nederlandse vestiging voor de verrichting van een GMP-LCI. De als zodanig geregistreerde /gecertificeerde Nederlandse vestiging ziet toe op de borging van de relevante procedures, resp. instructies.

4.8.3. Rapport van de bevindingen tijdens de Inspectie van de Lading Compartimenten [Vervallen per 01-01-2006]

Doelstelling [Vervallen per 01-01-2006]

De ladingsinspecteur is gehouden de bevindingen van de LCI alleen te rapporteren aan zijn opdrachtgever96.

Het uiteindelijke resultaat van de LCI kan alleen maar een definitieve acceptatie of afwijzing van de Ladingscompartimenten zijn. Het rapport van de LCI dient eenduidig te zijn en die informatie te bevatten, die relevant is voor de acceptatie van het Ladingscompartiment.

Rapportage inhoud [Vervallen per 01-01-2006]

Een rapportage van de bevinding van de LCI dient minimaal de volgende elementen te bevatten, die door de ladingsinspecteur aan de opdrachtgever moeten worden bevestigd in de vorm van een geschreven rapport:

  • a. Titel: Lading Compartimenten Inspectie Rapport - GMP.

  • b. Identiteit van het(de) vervoermiddel(len).

  • c. Omschrijving van de partij.

  • d. Naam van de opdrachtgever.

  • e. Bevestiging van de opdrachtomschrijving inhoudende de terminologie

    • GMP- Lading Compartimenten Inspectie.

    • Aard, aantal, nummers van de Ladingscompartimenten

  • f. Bevestiging dat de aangewezen lading - compartimenten geïnspecteerd zijn.

  • g. Tijdens deze inspectie is zover visueel geconstateerd kon worden, vastgesteld dat de lading compartimenten:

    • (Voor zover van toepassing) ledig, schoon, droog, reukloos zijn

    • de aanwezigheid van schadelijke insecten en ongedierte (dood en levend) niet vastgesteld is

    • Heel en sluitbaar zijn

  • a. Indien er sprake is van een deelpartij, een

    LCI in een 2de of volgende laadhaven en

    de partij wordt bijgeladen in een reeds gedeeltelijk beladen ladingcompartiment dient dit als zodanig te worden gerapporteerd. Alsmede moet een bevestiging gegeven worden van de visueel vastgestelde conditie van de zich reeds in het LC bevindende lading en de voorziene wijze van stuwage en/of separatie van de partij, waarover gerapporteerd wordt.

  • b. Op basis van de bevindingen dient verklaard te worden, dat mede op grond van de informatie t.a.v. voorafgaande ladingen het(de) ladingscompartiment-(en) geaccepteerd (is)zijn en in dit opzicht geschikt voor belading met de partij.

  • c. Plaats van de LCI

  • d. Datum en tijd van de LCI (eventueel begin en einde)

  • e. Het rapport geeft alleen weer, de bevindingen op het moment en de plaats van de LCI en ontslaat partijen niet van contractuele verplichtingen.

    In het kader van gemaakte afspraken tussen opdrachtgevers en controlebedrijven kunnen de bevindingen van de LCI onderdeel zijn van een algemene rapportage ten aanzien van de totale bewaking van de goederenstroom(GMP - convenant). Deze variant op de LCI- rapportage is alleen aanvaardbaar, indien de opdrachtgever van het controlebedrijf tevens eindverbruiker is van de goederen.

    De bevrachtingsovereenkomsten, de opdrachtverstrekkingen tot LCI en de ontvangen LCI-rapportages dienen in de administratie bewaard te worden gedurende minimaal een wettelijke termijn geldt als administratiebewaarplicht voor leveranciers van voeders voor herkauwers.

4.9. Procesbeheersing [Vervallen per 01-01-2006]

-

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

-

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

-

4.14. Corrigerende en preventieve maatregelen [Vervallen per 01-01-2006]

-

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

-

4.16. Beheersing van kwaliteitsregistraties [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

-

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

09. GMP-standaard handel en productie van toevoegingsmiddelen GMP09;11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied

3

2 Normatieve Verwijzingen

3

3 Termen, Definties, Doelgroepen

3

4 Kwaliteitssysteemeisen

3

 

4.1

Directieverantwoordelijkheid

3

 

4.2

Kwaliteitssysteem

3

 

4.3

Normen

3

 

4.4

Ontwerpbeheersing

3

 

4.5

Document- en Gegevensbeheer

3

 

4.6

Inkoop

3

  4.6.1 Toevoegingsmiddelen + grond- en hulpstoffen uit de agro-sector

3

  4.6.2 Aankoop van producten uit niet-agro-sectoren

3

  4.6.3 Actualisatie

4

  4.6.4 Op- en overslag

4

 

4.7

Beheersing van door de Afnemer verstrekte Producten

4

 

4.8

Identificatie en Naspeurbaarheid

4

 

4.9

Procesbeheersing

4

  4.9.1 Verwerking grond- en hulpstoffen 4
  4.9.2 Installaties voor synthese en mengen 4
  4.9.3 Opslag 4
  4.9.4 Bereiding van het toevoegingsmiddel 4
  4.9.5 Productievolgorde 5
  4.9.6 Meetapparatuur 5
  4.9.7 Transportsystemen 5
  4.9.8 Retourstromen 5
 

4.10

Keuring en Beproeving

5

  4.10.1 Ontvangst van grond- en hulpstoffen of toevoegingsmiddelen 5
  4.10.2 Kwaliteitscontroles toevoegingsmiddelen 5
 

4.11

Beheersing van Keurings-, Meet- en Beproevingsmiddelen

6

 

4.12

Keurings- en Beproevingsstatus

6

 

4.13

Beheersing van Producten met Afwijkingen

6

 

4.14

Corrigerende en preventieve Maateregelen

6

 

4.15

Behandeling, Opslag, Verpakking, Conservering en Aflevering

6

 

4.16

Beheersing van Kwalitetisregistraties

6

 

4.17

Interne Kwaliteitsaudits

6

 

4.18

Opleiding

6

 

4.19

Nazorg

6

 

4.20

Statistische Technieken

6

1. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

Deze GMP-standaard betreft een aanvulling op de algemene GMP-standaard diervoedersector (GMP01) en geldt voor de ondernemer, die toevoegingsmiddelen produceert of in de handel brengt. De algemene GMP- standaard voor de diervoedersector (GMP01) is integraal van toepassing.

Indien de ondernemer verrichtingen uitvoert waarvoor een aanvullende GMP-standaard bestaat (b.v. voor op- en overslag, transport, of handel in voedermiddelen), dient de ondernemer expliciet een GMP-certificatie voor die verrichting te verwerven.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

-

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

Voor de definities van o.a. voormengsels en toevoegingsmiddelen wordt verwezen naar de diervoederwetgeving, met name EU-richtlijn 70/524 en EU-richtlijn 82/471

4. Kwaliteitssysteem eisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

Eindproductspecificatie [Vervallen per 01-01-2006]

De ondernemer heeft het maximaal aanvaardbare verschil tussen gedeclareerd en geanalyseerd gehalte aan werkzame stof(fen) voor de bereiding van het toevoegingsmiddel vastgelegd. Deze dienen minimaal aan de wettelijk vastgestelde toleranties te voldoen.

4.3. Normen [Vervallen per 01-01-2006]

-

4.4. Ontwerpbeheersing [Vervallen per 01-01-2006]

-

4.5. Document- en gegevensbeheer [Vervallen per 01-01-2006]

-

4.6. Inkoop [Vervallen per 01-01-2006]

4.6.1. Toevoegingsmiddelen + grond- en hulpstoffen uit de agro-sector [Vervallen per 01-01-2006]

Onderstaande bepalingen gelden voor de aankoop van

  • grond- en hulpstoffen uit de agro-industrie, die de ondernemer gebruikt voor de productie van toevoegingsmiddelen,

  • niet-zelfgeproduceerde toevoegingsmiddelen die specifiek bedoeld zijn voor gebruik in diervoeder

De ondernemer koopt de hiervoor genoemde producten uitsluitend van leveranciers die gecertificeerd zijn, waarbij aantoonbaar op het moment van levering minimaal aan het volgende wordt voldaan:

  • 1. De leverancier is GMP04/05-gecertificeerd (bij levering van grond- en hulpstoffen uit de agro-industrie) resp. GMP09-gecertificeerd (bij levering van toevoegingsmiddelen).

Indien de ondernemer de grond- en hulpstoffen van een leverancier in het buitenland afneemt die niet aan het voorgaande voldoet, dient de ondernemer te voldoen aan de aanvullende voorwaarden voor de GMP- standaard voor de handelaren van voedermiddelen GMP05).

4.6.2. Aankoop van producten uit niet-agrosectoren [Vervallen per 01-01-2006]

Onder staande bepalingen gelden voor de aankoop van

  • grond- en hulpstoffen uit andere dan de agro-industrie97 , die de ondernemer gebruikt voor de productie van toevoegingsmiddelen,

    • niet-zelfgeproduceerde toevoegingsmiddelen die niet specifiek bedoeld zijn voor gebruik in diervoeder.

    Voorafgaand aan de aankoop voert de ondernemer zelf een op HACCP-principes gebaseerde risicobeoordeling van de bedoelde producten uit. Op basis van deze risicobeoordeling én de kwaliteitsborging, die de leverancier van het product toepast, maakt de ondernemer een leveranciersselectie en stemt hij zijn ingangscontrole daarop af.

4.6.3. Actualisatie [Vervallen per 01-01-2006]

Indien de normen voor grond- en hulpstoffen ingevolge de GMP-regeling wijzigen, gelden deze voor alle nieuwe aankopen op het moment van de inwerkingtreding ervan. Voor lopende contracten geldt een uitzondering, onder voorwaarde dat deze ten genoegen van het productschap en onverwijld en ten allen tijde kunnen worden getoond en waarbij de maximale looptijd van 8 maanden niet wordt overschreden.

4.6.4. Op- en overslag [Vervallen per 01-01-2006]

Producten die niet in eigen locatie worden op- en overgeslagen, zijn op- en overgeslagen bij GMP-gecertificeerde op- en overslagbedrijven. Indien dit niet mogelijk is, dienen minimaal gelijkwaardige kwaliteitswaarborgen te worden verkregen.

4.7. Beheersing van door de afnemer verstrekte producten [Vervallen per 01-01-2006]

-

4.8. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

-

4.9. Procesbeheersing [Vervallen per 01-01-2006]

4.9.1. Verwerking grond- en hulpstoffen [Vervallen per 01-01-2006]

Bij de verwerking van grond- en/of hulpstoffen tot een toevoegingsmiddel dient zodanig te worden gewerkt dat de juiste grond- en hulpstoffen, in de juiste dosering, in het juiste toevoegingsmiddel worden verwerkt.

4.9.2. Installaties voor synthese en mengen [Vervallen per 01-01-2006]

Installaties voor de bereiding van toevoegingsmiddelen dienen zo te zijn ontworpen en te functioneren dat:

  • a) een uniforme verdeling van de bestanddelen in het toevoegingsmiddel wordt verkregen;

  • b) na het bereiden de bestanddelen uniform in het toevoegingsmiddel verdeeld blijven totdat het toevoegingsmiddel wordt afgeleverd;

  • c) onacceptabele versleping van grond- en hulpstoffen wordt voorkomen

Indien in een installatie meerdere producten worden bereid dient bekend te zijn welke mate van versleping optreedt.

Voor installaties dient er een onderhoud-, controle- of inspectieschema vastgelegd te zijn, waarin frequentie en aard van de controles zijn vastgelegd, bijvoorbeeld controle op slijtage, aankoeken, hoeveelheid achtergebleven materiaal, enz.

4.9.3. Opslag [Vervallen per 01-01-2006]

Toevoegingsmiddelen dienen zodanig opgeslagen te zijn dat zij gemakkelijk geïdentificeerd kunnen worden en verwarring met andere producten uitgesloten wordt en de tijdige aflevering i.v.m. de uiterste verwerkingsdatum gerealiseerd kan worden.

In de opslagruimte dient waar relevant een apart deel aanwezig te zijn voor de opslag van grond- en hulpstoffen voor bereiding van toevoegingsmiddelen.

4.9.4. Bereiding van het toevoegingsmiddel [Vervallen per 01-01-2006]

In de receptuur dient de dosering van de te onderscheiden grond- en hulpstoffen voor bereiding van het toevoegingsmiddel te zijn vastgelegd.

Het transport van grond- en hulpstoffen, van oorspronkelijke verpakking of opslagsilo naar de meetapparatuur moet plaatsvinden met geëigende transportmiddelen.

Ingeval gebruik wordt gemaakt van doseersilo's, dient bij het vullen van deze silo's;

  • -

    een adequaat doseer- en vergrendelingssysteem te worden toegepast en;

  • -

    een transportvolgorde te worden vastgelegd, indien gebruik wordt gemaakt van gemeenschappelijke transportwegen.

Hiervoor dient een procedure te zijn vastgelegd.

4.9.5. Productievolgorde [Vervallen per 01-01-2006]

De gerealiseerde productievolgorde dient geadministreerd en gearchiveerd te worden.

4.9.6. Meetapparatuur [Vervallen per 01-01-2006]

De grond- en hulpstoffen voor de bereiding van het toevoegingsmiddel dienen met daartoe geëigende meetapparatuur te worden gewogen. In alle gevallen moet de meetapparatuur makkelijk schoon te maken zijn.

De meetapparatuur dient met betrekking tot het weegvermogen afgestemd te zijn op de hoeveelheden af te wegen product.

Van de meetapparatuur dient duidelijk te zijn aangegeven en vastgelegd:

  • a) de minimaal en maximaal toegelaten belasting van het meetapparaat;

  • b) de nauwkeurigheid van het apparaat;

Transport vanaf meetapparatuur naar installatie: er dient een zodanige beveiliging aangebracht te zijn, dat men er zeker van is dat al de afgewogen grond- en hulpstoffen inderdaad in het daarvoor bestemde toevoegingsmiddel terecht zijn gekomen.

4.9.7. Transportsystemen [Vervallen per 01-01-2006]

Transportsystemen voor electrostatisch gevoelige stoffen dienen deugdelijk te zijn geaard om elektrostatische oplading van deeltjes te voorkomen.

Het gehele transportsysteem dient in verband met afzetting van product goed toegankelijk te zijn om te kunnen worden gereinigd. Er dient een protocol voor reiniging van het gehele transportsysteem te worden vastgelegd en uitgevoerd.

Voor transportsystemen dient er een vastgelegd inspectie- en onderhoudsschema te zijn waarin frequentie en aard van de inspectie- en onderhoudsbeurten zijn vermeld en de bevindingen c.q. het verrichte onderhoud en de reparaties zijn vastgelegd.

4.9.8. Retourstromen [Vervallen per 01-01-2006]

Het omgaan met poedervormige stoffen afkomstig uit filters van pneumatische systemen van de installatie dient punt van aandacht te zijn. Er dient een procedure te zijn vastgelegd op welke wijze hiermee omgegaan wordt om versleping van grond- en hulpstoffen tegen te gaan.

Van externe retourstromen dient de kwaliteit bekend te zijn. Men dient zich er van te vergewissen of al dan niet vermenging of kruiscontaminatie op het externe bedrijf heeft plaatsgevonden. Voor het terughalen van dient een procedure te zijn vastgelegd.

4.10. Keuring en beproeving [Vervallen per 01-01-2006]

4.10.1. Ontvangst van grond- en hulpstoffen of toevoegingsmiddelen [Vervallen per 01-01-2006]

De ondernemer dient van de ontvangen partij grond- en/of hulpstoffen vastgelegd te hebben:

  • - de naam van de fabrikant/leverancier;

  • - de generieke naam van het grond- en hulpstoffen en/of het toevoegingsmiddel;

  • het charge- of referentienummer zoals toegekend door de fabrikant/leverancier;

  • - het (de) door de fabrikant/leverancier gegarandeerde gemiddelde gehalte(n) van de werkzame stof(fen) in grond- of hulpstoffen en/of het toevoegingsmiddel;

  • - de (aanvullende) gebruiksaanwijzingen; datum van ontvangst;

  • - houdbaarheidstermijn.

Bij de ontvangst van grond- en/of hulpstoffen en/of toevoegingsmiddelen, dient iedere verpakkingseenheid te worden gecontroleerd op beschadigingen en op de juiste wijze aangebrachte aanduidingen op het etiket of het begeleidend document.

Het gestelde in de voorgaande alinea's geldt voor de handelaar voor de te ontvangen toevoegingsmiddelen.

4.10.2. Kwaliteitscontroles toevoegingsmiddelen [Vervallen per 01-01-2006]

De ondernemer draagt zorg dat van iedere partij, of in geval van continu-productie, van elk bepaald productiegedeelte, voldoende

monsters worden genomen, die met het oog op traceerbaarheid moeten worden bewaard.

4.11. Beheersing van keurings-, meet- en beproevingsmiddelen [Vervallen per 01-01-2006]

-

4.12. Keurings- en beproevingsstatus [Vervallen per 01-01-2006]

-

4.13. Beheersing van producten met afwijkingen [Vervallen per 01-01-2006]

-

4.14. Coorigerende en preventieve maatregelen [Vervallen per 01-01-2006]

-

4.15. Behandeling, opslag, verpakking, conservering en aflevering [Vervallen per 01-01-2006]

De productinformatie en -begeleiding dient zodanig te zijn, dat de ondernemer goed in staat is om bij haar afnemers te bewerkstelligen dat zij het volgende in acht kunnen nemen:

  • - de toedieningsvoorschriften aan het toevoegingsmiddel;

  • - specifieke opslag- en gebruikscondities voortvloeiend uit de eigenschappen van de verwerkte grond- en/of hulpstoffen.

De geleverde kwaliteit voldoet aan de door de afnemer gehanteerde en met de ondernemer afgesproken normspecificatie.

Gegevens met betrekking tot veilig werken met de grond- en hulpstoffen en toevoegingsmiddelen en (aanvullende) gebruiksaanwijzingen worden expliciet al dan niet (verplicht) op het etiket aangegeven.

De voor vermelding relevante bepalingen die bij registratie van de toevoeging- en diergeneesmiddelen zijn aangegeven dienen expliciet al dan niet op het etiket te zijn aangegeven.

4.16. Beheersing van kwaliteitsregistratie [Vervallen per 01-01-2006]

-

4.17. Interne kwaliteitsaudits [Vervallen per 01-01-2006]

-

4.18. Opleiding [Vervallen per 01-01-2006]

-

4.19. Nazorg [Vervallen per 01-01-2006]

-

4.20. Statistische technieken [Vervallen per 01-01-2006]

-

10. GMP-standaard laboratorium bedrijfsinterne controle diervoedersector GMP10;11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp en Toepassingsgebied

3

2 Normatieve Verwijzingen

3

 

2.1

Kwaliteitsschema

3

 

2.2

Organisatieschema

3

 

2.3

Beheer kwaliteitssysteem

3

3 Termen, Definties, Doelgroepen

3

 

3.1

Vastleggen

3

 

3.2

Handboek

4

4 Inrichting

4

5 Personeel

4

6 Apparatuur

4

7 Monster, Standaarden, Referentie- en Hulpmateriaal

5

8 Voorschriften

5

9 Registratie, Rapprtage en Archievering

5

10 Kwaliteitscontroleplan en Interne Audit

6

11 Ringonderzoek

6

12 Uitbesteding aan andere Laboratoria

6

13 Klachtenbehandeling

7

14 Toelichting

7

1. Doel en toepassingsgebied [Vervallen per 01-01-2006]

1.1. Doel [Vervallen per 01-01-2006]

Uitvoeren van analyses in monsters toevoegingsmiddelen, voedermiddelen, voormengsels en diervoeders in het kader van de kwaliteitsborging volgend de GMP-regeling diervoedersector dient op zodanige wijze plaats te vinden, dat de betrouwbaarheid van geproduceerde resultaten op een voldoende niveau wordt beheerst en geborgd. Dit dient betrokkene zelf, via een kwaliteitsborgingssysteem, aantoonbaar te maken.

Certificatie vindt plaats per type verrichting, in combinatie met de analysemethode en matrix, welke ook in het certificaat worden vastgelegd. Een verrichting is datgene wat met een analysemethode kan worden geanalyseerd.

1.2. Toepassingsgebied: [Vervallen per 01-01-2006]

Deze standaard is bedoeld voor laboratoria die onderzoek uitvoeren in het kader van bedrijfsinterne controle (kwaliteitscontrole) ingevolge de GMP-regeling in ondernemingen in de diervoedersector.

Het laboratorium dient de kritische punten van monsterontvangst, -opslag & -behandeling, onderzoek, registratie, rapportage en archivering te beheersen en te borgen.

2. Organisatie en kwaliteitsbeleid [Vervallen per 01-01-2006]

2.1. Kwaliteitssysteem [Vervallen per 01-01-2006]

Het laboratorium dient een kwaliteitssysteem te hebben waarin is opgenomen de organisatie en documentatie van de verantwoordelijkheden, bevoegdheden, de procedures, de processen en de voorzieningen met betrekking tot het beheersen en het borgen van de betrouwbaarheid van analyseresultaten. De verantwoordelijkheid voor de goede opzet en het functioneren van het kwaliteitssysteem berust bij de directie van de onderneming.

2.2. Organisatieschema [Vervallen per 01-01-2006]

Een organisatieschema dient aan te geven hoe het laboratorium in de organisatie van de onderneming is opgesteld. Het laboratorium en personeel dient binnen de organisatie een onafhankelijke positie te hebben t.o.v. de eventuele activiteiten van voortbrenging en verhandeling van toevoegingsmiddelen, voedermiddelen, voormengsels en diervoeders elders in de onderneming. De beheerder van het kwaliteitssysteem dient rechtstreeks toegang te hebben tot de directie van de onderneming. Voorts dient de interne inspectie (interne audit) uitgevoerd te worden door een persoon die in voldoende mate onafhankelijk staat t.o.v. de te auditen activiteit. Verder dient de auditor voldoende kennis te bezitten van de te auditen activiteit.

2.3. Beheer kwaliteitssysteem [Vervallen per 01-01-2006]

Er dient een procedure te zijn, waarin de bevoegdheden zijn geregeld betreffende het wijzigen, aanpassen, aanvullen, of herzien van het kwaliteitssysteem. Binnen het bedrijf is een beheerder aangewezen, die verantwoordelijk is voor de actualiteit, het beheer en verspreiding van het handboek.

3. Documentatie [Vervallen per 01-01-2006]

3.1. Vastleggen [Vervallen per 01-01-2006]

Wat betreft het vastleggen van zaken voor zowel het functioneren van het laboratorium, als ook voor het aantoonbaar maken naar de beoordelaar is het nodig dat alle door het laboratorium in het kwaliteitssysteem aangegeven zaken zijn vastgelegd ofwel duidelijk waarneembaar zijn. Iedereen binnen het laboratorium die onderdelen van dit kwaliteitssysteem aangaat moet dit ook begrijpen en hier daadwerkelijk naar handelen.

Het zij duidelijk dat het alleen op papier vastleggen zeker niet voldoende is. Ook bij de mensen op de werkvloer, bij de apparatuur, inrichting e.d. moet actueel aantoonbaar zijn dat de aan de orde zijnde elementen van deze standaard functioneren.

3.2. Handboek [Vervallen per 01-01-2006]

Één va n de voorwaarden voor het functioneren van het kwaliteitssysteem is het vastleggen van dit systeem in een handboek. Alleen op deze wijze is de samenhang tussen de kritische punten en de kwaliteit van analyseresultaten voor het laboratorium helder te maken.

Het op schrift stellen van het kwaliteitssysteem resulteert in het handboek. Het handboek is een doorlopend naslagwerk bij de uitvoering en het op peil houden van het kwaliteitssysteem. Het handboek dient aantoonbaar actueel te zijn.

3.3. Datum en autorisatie [Vervallen per 01-01-2006]

De voorschriften en procedures dienen voorzien te zijn van datum en geautoriseerd door een daartoe door de directie van de onderneming bevoegd verklaarde persoon.

4. Inrichting [Vervallen per 01-01-2006]

De omgeving / locatie waarin de analysewerkzaamheden worden uitgevoerd mogen de juistheid en nauwkeurigheid van analyseresultaten niet beïnvloeden.

Er is een door de directie goedgekeurde toegangsregeling tot het laboratorium, waarmee wordt bereikt dat de integriteit van de resultaten niet wordt beïnvloed. Ten minste het volgende is geregeld:

  • a. monsteropslag beveiligd

  • b. data beveiligd

  • c. toegang voor alleen bevoegden.

Het laboratorium is er alleen voor laboratoriumpersoneel toegankelijk. Derden mogen de ruimten alleen in aanwezigheid van laboratoriumpersoneel.

Er dienen voorzieningen te zijn voor:

  • a. ontvangst en opslag van monstermateriaal;

  • b. opslag van monsters;

  • c. het reinigen van glaswerk en andere benodigdheden;

  • d. de bereiding en opslag van hulpstoffen;

  • e. de uitvoering van het onderzoek, inclusief monstervoorbereiding

Deze voorzieningen dienen adequaat te zijn in relatie tot de doelstelling van het kwaliteitssysteem.

5. Personeel [Vervallen per 01-01-2006]

Voor het beheersen en het borgen van een goede kwaliteit van voortgebrachte analyseresultaten is het personeel van cruciaal belang. Het personeel moet derhalve voldoende kennis en vaardigheid hebben voor de aan hen in dit kader opgedragen taken.

Om dit te bewerkstelligen is het in ieder geval nodig dat:

  • a. de taken, verantwoordelijkheden en bevoegdheden schriftelijk en duidelijk aan hen kenbaar zijn gemaakt;

  • b. er een procedure aanwezig en vastgelegd is, waarmee gewaarborgd wordt dat al het betrokken personeel bekend is met de benodigde instructies en normen. Regelmatig en zeker bij essentiële wijzigingen worden zij opnieuw, minimaal schriftelijk, geïnformeerd. Deze procedure geldt ook voor tijdelijk personeel;

  • c. het personeel in voldoende mate is opgeleid en nageschoold. Dit dient te blijken uit personeelsdossiers en/of een opleidingsprogramma

6. Apparatuur [Vervallen per 01-01-2006]

Met betrekking tot de apparatuur en hulpmiddelen, die van invloed kunnen zijn op de uitkomsten van de analyses, dient te zijn vastgelegd:

  • a. een inventarisatie van aanwezige apparatuur en de toegepaste wijze van identificatie;

  • b. een onderhoudssysteem met vermelding van de frequentie en de aard van de te verrichten onderhoudswerkzaamheden, met inbegrip van ijking, justering, calibratie en validatie, alsmede wie bevoegd is deze werkzaamheden te verrichten;

  • c. de gebruiksgeschiktheid van kwaliteitsbepalende apparatuur voor ieder gebruik: bij afwijkingen aan apparatuur: de maatregelen die zijn en moeten worden getroffen met betrekking tot het gebruik van apparatuur en de beoordeling van de geldigheid van eerder verkregen onderzoeksresultaten

Bij elk apparaat dienen de onderhoudswerkzaamheden, verholpen storingen, kalibraties, justeringen en validaties als genoemd in 6.1 te worden geregistreerd in een logboek.

Niet goed functionerende apparatuur moet als zodanig gemerkt zijn ('quarantaine').

7. Monsters, standaarden, referentie- en hulpmateriaal [Vervallen per 01-01-2006]

Er dienen specificaties te zijn voor de gewenste kwaliteit van standaarden, referentie- en hulpmateriaal (chemicaliën). Deze dienen te zijn vastgelegd.

Bj de ontvangst van standaarden, referentie- en hulpmateriaal dient te worden gecheckt of daadwerkelijk is ontvangen hetgeen is besteld.

Er dient inzicht aanwezig te zijn in de kwaliteit en betrouwbaarheid van de toeleveranciers van standaarden, referentie- en hulpmateriaal. Op basis hiervan dient een lijst van toegelaten leveranciers te worden aangelegd.

Er dient controle van kritische standaarden, referentie- en hulpmateriaal op bruikbaarheid plaats te vinden. De controlefrequentie is afhankelijk van de mate waarin standaarden, referentie- en hulpmateriaal kritisch zijn voor de uitkomsten van de analyses. Hiervoor dient een procedure te zijn vastgelegd.

Standaarden, referentie- en hulpmateriaal dienen eenduidig te zijn geïdentificeerd en te zijn voorzien van expiratiedatum en opslagcondities indien deze van belang zijn voor de kwaliteit.

In alle stadia van opslag, monsterbehandeling, monstervoorbereiding en onderzoek dienen voorzorgsmaatregelen aanwezig te zijn om mogelijke ongunstige beïnvloeding van het analyseresultaat te vermijden. Hiervoor dienen instructies aanwezig te zijn waarop toezicht wordt uitgeoefend.

Er zijn instructies voor ontvangst, houdbaarheid / opslagduur en vernietiging van monsters, standaarden, referentie- en hulpmateriaal.

8. Voorschriften [Vervallen per 01-01-2006]

Er dienen voorschriften aanwezig te zijn voor:

  • a. de bediening, onderhoud, kalibratie en justering van apparatuur;

  • b. de monsterbehandeling;

  • c. de uitvoering van het onderzoek (de analyse), inclusief de daarbij te verrichten controlebepalingen (bij elke serie dient een controlemonter mee te lopen, de frequentie is afgestemd op enkelvoud of dubio bepaling), de wijze waarop de resultaten van de controlebepalingen worden geïnterpreteerd, alsmede de registraties en rapportages van de resultaten. De verantwoordelijkheid voor acceptatie en rapportage van analyseresultaten dient eenduidig te zijn vastgelegd;

  • d. aangegeven is wanneer monsters in enkelvoud of in duplo worden bepaald

  • e. de onderzoekvoorschriften vastgelegd door het Productschap Diervoeder gelden als referentiemethode. Bij gebruik van andere onderzoekvoorschriften moet uit het validatierapport aantoonbaar blijken dat deze gelijkwaardig zijn op basis van bepaalbaarheidsgrenzen, precisie (herhaalbaarheid), juistheid, specificiteit en selectiviteit.

In elk onderzoeksvoorschrift dient minimaal een beschrijving vastgelegd te zijn van

  • a. apparatuur;

  • b. reagentia;

  • c. overige hulpmiddelen; en

  • d. acceptatiecriteria voor de verkregen analyseresultaten.

Tevens dient vastgelegd te zijn of en wanneer de bepaling in enkelvoud of duplo wordt uitgevoerd. Bij analyse in enkelvoud dienen voldoende waarborgen ingebouwd te zijn, b.v. door introductie van meer controlebepalingen, om de kwaliteit van het analyseresultaat te garanderen.

De actuele voorschriften dienen bekend te zijn bij de betrokken medewerkers. Er dient gewerkt te worden conform de voorschriften.

9. Registratie, rapportage en archivering [Vervallen per 01-01-2006]

De volgende gegevens dienen eenduidig te worden geregistreerd:

  • a. identiteit van het monster (aard, herkomst, monsternummer);

  • b. datum van monsterontvangst;

  • c. toegepaste methode van onderzoek;

  • d. analyseresultaat/-resultaten; bij microbiologische bepalingen met vermelding van de in onderzoek genomen hoeveelheid;

  • e. resultaten van bevestigingen (indien van toepassing);

  • f. resultaten van de controlebepalingen. Vastlegging en beoordelingen vindt plaats volgens de in 11.2 en 11.3 beschreven systematiek;

  • g. eventueel gesignaleerde bijzonderheden;

  • h. namen van degenen die het onderzoek hebben uitgevoerd en de resultaten hebben geautoriseerd.

De registraties dienen voldoende beveiligd te zijn om ongewenste verdwijning tegen te gaan en mogen alleen verifieerbaar worden gewijzigd.

Resultaten mogen alleen door daartoe bevoegde personen namens het laboratorium worden gerapporteerd. In het rapport wordt het volgende van elk monster vermeld:

  • a. identiteit van het monster;

  • b. monsternummer;

  • c. eventuele batch-/referentienummer (van de opdrachtgever);

  • d. datum van ontvangst van het monster;

  • e. eindresultaat V-resultaten;

  • f. eventuele opmerkingen;

  • g. datum van rapportage en autorisatie door de voor de rapportage verantwoordelijke persoon;

  • h. degene aan wie rapportage wordt gericht.

Gegevens die van belang zijn om te kunnen reconstrueren hoe een bepaalde uitslag tot stand gekomen is, dienen te worden bewaard. Archivering (eventueel electronisch) gedurende minimaal 2 jaar dient plaats te vinden van:

  • a. de registraties als bedoeld in 9.1.

  • b. een kopie van elk rapport als bedoeld in 9.2

  • c. de apparatuurlogboeken als bedoeld in 6.2

  • d. resultaten van interne inspectie en controle

  • e. vervangen documenten (handboek, procedures, voorschriften, enz.)

Er dient een adequate beveiliging van informatie plaats te vinden tegen onbevoegde inzage en/of wijziging daarin.

10. Kwaliteitscontroleplan en interne audit [Vervallen per 01-01-2006]

Door het laboratorium is een kwaliteitscontroleplan opgesteld, waarin alle voor het kwaliteitssysteem relevante controles zijn vastgelegd. De resultaten worden vergeleken met de bedrijfsintern gestelde eisen.

Het controleplan bevat tenminste de volgende onderdelen:

  • a. identificatie van kritische punten in logische en systematische volgorde;

  • b. controles en de frequentie ervan;

  • c. verantwoordelijke personen die controles uitvoeren,

De resultaten van het kwaliteitscontroleplan worden vastgelegd op daarvoor ontwikkelde inspectieformulieren, waarop ten minste is vermeld:

  • a. wat geïnspecteerd dient te worden en het resultaat;

  • b. welk laboratoriumonderdeel;

  • c. datum inspectie;

  • d. naam van de inspecteur;

  • e. ondernomen acties.

Het laboratorium dient een onderzoek in te stellen naar de oorzaak van afwijkingen en deze, indien van toepassing, te verhelpen. Deze actie, motivatie, alsmede het resultaat dienen te worden geadministreerd.

De interne audit dient minimaal éénmaal per jaar te worden uitgevoerd.

De resultaten, evaluatie van de resultaten en ondernomen acties worden gerapporteerd aan de directie van het laboratorium. De (eind)verantwoordelijkheid voor het ondernemen van acties bij afwijkingen ligt bij de directie van de onderneming.

11. Ringonderzoek [Vervallen per 01-01-2006]

Het laboratorium dient deel te nemen aan interlaboratoriumonderzoeken (ringtesten) voor de door het laboratorium gebruikte analysemethoden, waar mogelijk gebaseerd op proficiency testing .

Per verrichting dienen de resultaten van het laboratorium t.o.v. het gemiddelde, berekend voor de betreffende ringtest, te worden bijgehouden en geadministreerd gedurende minimaal 3 jaar. De resultaten dienen als afwijking van dit gemiddelde uitgedrukt in het aantal keren de spreiding (s), berekend voor de betreffende ringtest, te worden weergegeven in een overzicht of grafiek.

He laboratorium dient een onderzoek in te stellen naar de oorzaak van afwijkingen en deze, indien van toepassing, te verhelpen als aan de orde is:

  • één keer een afwijking van meer dan 3 x s;

  • twee achtereenvolgende keren aan dezelfde zijde van het gemiddelde een afwijking van meer dan 2 x s;

  • of 11 keer achtereenvolgend een resultaat aan dezelfde zijde van het gemiddelde.

Deze actie, motivatie, alsmede het resultaat dienen te worden geadministreerd.

12. Uitbesteding aan andere laboratoria [Vervallen per 01-01-2006]

Uitbesteding van analysewerkzaamheden kan alleen plaatsvinden aan laboratoria die voor die verrichtingen in het kader van deze standaard of daaraan gelijkwaardige standaard gecertificeerd is

Uitbestede verrichtingen komen niet in aanmerking voor certificatie.

Indien analyses worden uitbesteed aan derden, dient op de rapportage aan de opdrachtgever m duidelijk te worden vermeld dat de analyse niet zelf is verricht, maar is uitbesteed.

13. Klachtenbehandeling [Vervallen per 01-01-2006]

Het laboratorium dient een systeem te hebben voor registratie en behandeling van klachten.

14. Toelichting [Vervallen per 01-01-2006]

In het kader van de verschillende GMP-standaarden neemt de bedrijfsinterne controle (kwaliteitscontroleplan) een belangrijke plaats. Voor een deel zal deze controle plaats vinden door middel van laboratoiumonderzoek. De kwaliteit van het laboratoriumonderzoek is daarom een essentieel onderdeel van de kwaliteitsborging in de diervoedersector.

Deze Laboratoriumstandaard is opgesteld ten behoeve van de borging van het kwaliteitsniveau van deze analysewerkzaamheden

de satndaard bestaat in hoofdlijnen uit de volgende drie elementen:

  • a. minimum eisen aan het kwaliteitssyteem van een laboratorium, afgeleid van EN 17025.

  • b. toepassen van officiële methoden, waardoor uniformiteit is gewaarborgd (dan wel methoden die aantoonbaar gelijkwaardig presteren)

  • c. deelname aan interlaboratoriumonderzoek op basis van prociciency-testing

De certificering op basis van deze GMP-standaard kan gecombineerd worden met een certificatie op basis van ISO 17025.

11. GMP-standaard teelt van voedermiddelen GMP11;11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Voorwoord 3
2 Onderwerp en Toepas-singsgebied 3
3 Normatieve Verwijzingen 4
4 Termen, Definities, Doelgroepen 4
 

4.1

Termen en Definities

4

 

4.2

Doelgroep

4

5 Kwaliteitssysteemeisen 4
 

5.1

Normen

4

 

5.2

Identificatie en Naspeurbaarheid van Producten

4

 

5.3

Procesbeheersing

5

  5.3.1 Teelt 5
  5.3.2 Oogst en inschuren 5
  5.3.3 Opslag (op de boerderij) 6
  5.3.4 Afleveren 7
  5.3.5 Loonwerk 7

1. Voorwoord [Vervallen per 01-01-2006]

In de GMP-standaard voor handel in voedermiddelen wordt als uitgangspunt gehanteerd een GMP-gecertificeerde onderneming uitsluitend voedermiddelen koopt van een akkerbouwer, die GMP-gecertificeerd is ingevolge de GMP-standaard teelt van voedermiddelen (GMP11), of volgens een daarmee door het productschap verklaarde uitwisselbare kwaliteitsstandaard98

Het was de bedoeling hierbij aan te sluiten bij een basiscertificaat voor kwaliteitsborging in de akkerbouwsector. Deze komt echter op dit moment niet tot stand. Om die reden hebben de aardappelverwerkende en suikerbietverwerkende industrieën besloten een eigen voedselveiligheidstandaard op te stellen en vanaf medio 2003 te implementeren. Met deze GMP-standaard voor teelt van voedermiddelen wordt hierop aangesloten. Uitgangspunt is wel dat de beoordeling op het voldoen aan deze standaard plaatsvindt tezamen met eventuele andere van toepassing zijnde standaarden.

De intentie is om, zodra er een basiscertificaat voor de gehele akkerbouwsector komt voor de borging van voedselveiligheid, hierop aan te sluiten.

Met deze standaard wordt aangesloten bij de ontwikkeling van kwaliteitsborging in de Nederlandse akkerbouw. In de huidige situatie is het van toepassing bij aankoop van producten door GMP-gecertificeerde bedrijven. Bij uitbreiding van GMP-deelname in andere landen zal met betrokken landen overleg plaatsvinden in welke mate ook op een soortgelijke ontwikkeling aldaar kan worden aangesloten.

Door het betrekken van producten van akkerbouwers, die een kwaliteitsborging als bedoeld in deze standaard toepassen, verminderen de potentiële risico's, waardoor het voor de GMP-gecertifieerde handelaar mogelijk is de ingangscontrole hierop ook aan te passen.

Deze standaard is van toepassing vanaf inzaai 1 januari 2005, wat dus bekent dat de producten van de eerstvolgende oogst in 2005 als eerste geproduceerd onder deze standaard op de markt komen.

2. Onderwerp en toepassingsgebied [Vervallen per 01-01-2006]

De GMP-regeling diervoedersector is opgezet voor de productie van, handel in, transport en op- en overslag van voedermiddelen, diervoeders, voormengsels en toevoegingmiddelen.

Voor de verschillende schakels in de diervoederkolom bestaan GMP-standaarden (GMP01 t/m GMP13). Deze GMP- standaard voor de teelt van voedermiddelen (GMP11) biedt de borging van de eerste stap in de diervoederkolom, namelijk de agrarische productie van voedermiddelen op het landbouwbedrijf.

Het doel van de GMP-regeling is producten en diensten voort te brengen, op een wijze die in hoge mate waarborgt dat leveranciers van deze producten en diensten voldoen aan de eisen in wet- en regelgeving, verband houdende met de veiligheid voor mens, dier en milieu (basiskwaliteit) van diervoeders én aan de additionele eisen die overeengekomen zijn met de ketenpartijen in de dierlijke productieketen in het kader van IKB-regelingen van de vee-, vlees-, eieren- en KKM-regeling in de zuivelsector of aanvullende kwaliteitsregelingen.

Het zelf door de ondernemer, via een kwaliteitsborgingsysteem, aantoonbaar maken dat basiskwaliteit wordt gewaarborgd is de basis voor de integrale ketenbeheersing (IKB) in de veehouderijsectoren. Diervoeders, geleverd door GMP-gecertificeerde ondernemers, zijn een voorwaarde in IKB programma's voor de verschillende diersectoren.

Voor de GMP-standaarden (GMP02 t/m GMP09) geldt dat de algemene GMP-standaard diervoedersector (GMP01), met minimum eisen aan het kwaliteitsysteem van een bedrijf, ook van toepassing is. Daarnaast geldt een aantal aanvullende eisen, waaronder de HACCP-criteria en aanvullende specifieke beheersmaatregelen die afgeleid zijn van de risicobeoordeling.

Bij deze GMP-standaard voor de teelt van voedermiddelen (GMP11) is de algemene GMP-standaard diervoedersector (GMP01) niet van toepassing. Het bevat een aantal praktische beheersmaatregelen, die gebaseerd zijn op een op HACCP gebaseerde risicobeoordeling van voedermiddelen in de teeltfase. Bij HACCP (Hazard Analyses of Critical Control Points) worden alle stappen in het voortbrengingsproces geanalyseerd en worden de potentiële gevaren (hazards) voor productkwaliteit en -veiligheid geïdentificeerd en beschreven. Alle mogelijke risico's voor productkwaliteit en -veiligheid moeten adequaat via opgestelde procedures en instructies worden beheerst.

3. Normatieve verwijzingen [Vervallen per 01-01-2006]

Deze GMP-standaard is een onderdeel van de GMP-regeling diervoedersector.

Het doel is te voldoen aan de eisen omtrent basiskwaliteit. Dit behelst de normen en voorschriften zoals vastgelegd in de diervoederwetgeving, aangevuld met aanvullende normen, met de dierlijke productieketen op sectoraal niveau in het kader van de GMP-regeling diervoedersector afgesproken.

De normen en voorschriften die in het kader van deze GMP-standaard geborgd dienen te worden, zijn vastgelegd in het kader van deze GMP-regeling diervoedersector (GMP14: Productnormen GMP diervoedersector).

4. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

4.1. Termen en definities [Vervallen per 01-01-2006]

Voor de definitie van onderstaande termen wordt verwezen naar de GMP-regeling diervoedersector en de EG-richtlijnen met betrekking tot diervoeders.

Er wordt tevens aangesloten bij de termen en definities van ISO 8402:1994.

Aanvullend zijn de volgende termen van toepassing:

Afnemer [Vervallen per 01-01-2006]

Diegene die producten/diensten koopt van de ondernemer.

Ondernemer [Vervallen per 01-01-2006]

Met ondernemer wordt verstaan de ondernemer waarop de GMP-standaard van toepassing is.

Risico [Vervallen per 01-01-2006]

De waarschijnlijkheid dat een bepaald potentieel gevaar (hazard) een negatief effect heeft.

4.2. Doelgroepen [Vervallen per 01-01-2006]

De doelgroepen van deze GMP-standaard zijn

  • a) ondernemers die voedermiddelen telen voor verkoop aan ondernemers die de producten de bestemming diervoeder geven

  • b) ondernemers die voedermiddelen telen voor vervoedering aan dieren op het eigen bedrijf.

5. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

5.1. Normen [Vervallen per 01-01-2006]

De wettelijke normen voor gebruik van technische hulpstoffen en voor voedermiddelen zijn van toepassing.

5.2. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

Voedermiddelen dienen traceerbaar te zijn vanaf de aankoop van het uitgangsmateriaal (inclusief hulpstoffen zoals gewasbeschermingsmiddelen, bemestingsmiddelen etc.) tot en met de verkoop, inclusief transport.

De teler dient minimaal de volgende gegevens in de administratie vast te leggen:

  • -

    welke percelen gebruikt worden voor de teelt van voedermiddelen voor de diervoedersector (bijvoorbeeld: Aanvraag oppervlakten =Mc Sharry aanvraag);

  • -

    ingekochte producten (o.a. zaaizaad, pootgoed, gewasbeschermingsmiddelen, bemestingsmiddelen) Bijvoorbeeld: Bijvoorbeeld: Nota's fiscale administratie;

  • -

    voor elke teelt (eventueel per perceel) de datum van behandeling, toegepaste behandelingen (incl. gebruikte middelen en hoeveelheid),zoals opgenomen in de eigenadministratie, zoals het Spuitboekje

  • -

    Stamboekafnemers en hoeveelheid afgeleverd product (bijvoorbeeld: afrekening fiscale administratie);

Daarnaast dienen registraties van controles en inspecties, alsmede analyses en certificaten minimaal 5 jaar bewaard te worden op een dusdanige wijze dat deze makkelijk toegankelijk zijn.

5.3. Procesbeheersing [Vervallen per 01-01-2006]

5.3.1. Teelt [Vervallen per 01-01-2006]

De teler dient te voldoen aan de residunormen zoals vastgelegd in de diervoederwetgeving, bestrijdingsmiddelenwetgeving en mestwetgeving.

  • a. Keuze uitgangsmateriaal

    • -

      Bij graanteelt bij voorkeur gebruikmaken van 100% ontsmet zaaizaad (ter voorkoming van en de aanwezigheid van schimmels);

  • b. Perceel

    • -

      De perceelhistorie is van onbesproken aard;

    • -

      Bij twijfel m.b.t. de perceelhistorie de grond analyseren door een gecertificeerd laboratorium op het gebied van grondonderzoek (b.v. Ooster-beek);

  • c. Gebruik gewasbeschermingsmiddelen/graanontsmettingsmiddelen

    • -

      Uitsluitend gebruik wettelijk geregistreerde middelen, met een toelating voor het betreffende gewas;

    • -

      De middelen toepassen volgens het wettelijk gebruiksvoorschrift en de gebruiksaanwijzing op de verpakking;

    • -

      Bijhouden van een administratie van gebruikte middelen (ook na oogst (zie 4.7), zoals opgenomen in de eigen administratie, zoals het spuitboekje;

    • -

      Gebruik maken van een goed afgestelde en goed werkende spuit en indien van toepassing een goedgekeurde spuit en spuitlicentie;

  • d. Bemesting

    • -

      Bemestingsadvies opvolgen (bij voorkeur m.b.v. analysecijfers);Geen GFT compost op perceel opbrengen, tenzij BOOM verklaringaanwezig is en uit analyse blijkt dat er geen sprake is van verontreiniging met glas, zware metalen;

    • -

      Gebruik maken van een goedwerkende en indien van toepassing een goedgekeurde strooier;

    • -

      Bijhouden van een administratie van gebruikte meststoffen (zie 4.2); (bijvoorbeeld: fiscale administratie).

  • e. Schimmelziekte

    • -

      Bij de aanwezigheid van schimmels de afnemer op de hoogte brengen;

  • f. Ongewenste stoffen

    • -

      Bij vaststellen van contaminatie met onkruidzaden, vlasdodde en zwartemosterd, dit melden bij de afnemer;

  • g. GGO

    • -

      Teelt van GGO rassen alleen toegestaan indien deze voldoen aan de wettelijke voorschriften;

    • -

      Het gebruik van GGO rassen afstemmen met de afnemer.

5.3.2. Oogst en inschuren [Vervallen per 01-01-2006]

Tijdens het oogsten en inschuren dient beschadiging van het product en de insleep van vreemde bestanddelen (zoals o.a. glas, steentjes, machineonderdelen door slijtage, GGO producten) voorkomen te worden.

5.3.3. Opslag (op de boerderij) [Vervallen per 01-01-2006]

5.3.3.1. Bedrijfsinrichting [Vervallen per 01-01-2006]

Indien de producten voor aflevering in tussenopslag gaan, dient de bedrijfsinrichting zodanig te zijn dat het geoogste product niet in aanraking kan komen met andere voedermiddelen.

Producten die niet op het eigen bedrijf in tussenopslag gaan, dienen opgeslagen te worden bij door het Productschap gecertificeerde bedrijven.

5.3.3.2. Bedrijfshygiëne [Vervallen per 01-01-2006]

De producten mogen niet in aanraking komen met veevoedervreemde producten zoals bemestingsproducten, gewasbeschermingsmiddelen, glas, hout, machineonderdelen etc. Het bedrijf dient hiervoor de volgende beheersmaatregelen in acht te nemen:

Het geoogste product dient hygiënisch opgeslagen te worden in schone en drogeruimten. Dit om microbiologische besmetting en broei te voorkomen;

Indien de producten worden gedroogd dient men, om contaminatie met toxische componenten door direct contact met verbrandingsgassen, onvolledige verbranding en verontreinigde brandstoffen te voorkomen (o.a. dioxine, pak's en NOx en SOx) de volgende voorzorgen te nemen:

  • -

    Specificatie van de kwaliteit van de brandstoffen, alsmede de afspraken met de leveranciers hierover, gebaseerd op een risicobeoordeling. Uitgangspunt is dat uitsluitend minerale brandstoffen (gas, steenkool, aardolie)worden gebruikt die volgens de specificatie van de leveranciers geschikt zijnvoor het drogen van voedingsmiddelen;

  • -

    Specificatie van de beheersmaatregelen ter voorkoming van verontreiniging van de brandstoffen tijdens de opslagen het transport;

  • -

    Specificatie van de controle op de kwaliteit van de brandstoffen;

  • -

    Specificatie van de instelling van de brander- en drogerinstallatie ter voorkoming van de vorming van ongewenste stoffen.

5.3.3.3. Vogels, huisdieren en ongedierte [Vervallen per 01-01-2006]

Het bedrijf dient maatregelen te treffen waardoor de aanwezigheid van huisdieren, vogels, ongedierte en insecten en hun uitwerpselen wordt voorkomen.

  • -

    Voorkomen dat vogels en huisdierenen hun uitwerpselen in contact kunnenkomen /nestelen met het (opgeslagen)product (o.a. deuren en ramen dicht, product afgedekt);

  • -

    Ongedierte voorkomen via het spannen van gaas voor de in- en uitlaatluiken;

  • -

    De voorraad bestrijdingsmiddelen dienen opgeslagen te worden in een afgesloten ruimte;

5.3.4. Afleveren [Vervallen per 01-01-2006]

Inregenen en besmetting met uitwerpselen van vogels wordt voorkomen door de lading af te dekken tijdens uitschuren en transport naar de afnemer. Daarnaast geldt dat de laadruimte en technische hulpwerktuigen van de gebruikte transportmiddelen schoon dienen te zijn.

  • -

    Alle producten welke niet voldoen aan de voorwaarden uit de standaardvoor de teelt van voedermiddelen voor de diervoedersector bij afleveren verwijderen;

  • -

    Uitsluitend gebruik maken van schone, goed onderhouden apparatuur:

    • vrij van resten en geur van voorgaande ladingen;

    • vrij van resten van reinigings en/of desinfectiemiddelen;

    • droog.

Teler is verantwoordelijk en ziet toe op verlading juiste partij.

5.3.4.1. Afleveren in eigen beheer [Vervallen per 01-01-2006]

Indien het transport wordt uitgevoerd in eigen beheer dient reiniging van de transportmiddelen plaats te vinden volgens het reinigings- en ontsmettingregime zoals vermeld in de GMP standaard transport. Dit betekent dat voor transport van diervoedergrondstoffen de wagen- /hulpmiddelen/fusten minimaal gereinigd dient te worden volgens onderstaande eisen.

Na vervoer van:

  • a. Diervoedergrondstoffen: vegen

  • b. grond/stenen: reinigen met water (hoge druk)

  • c. kunstmest: reinigen met water

  • d. droge stapelbare pluimvee- en paardenmest: reinigen met water + desinfectie

  • e. natie mest, drijfmest: reiniging, desinfectie en vrijgave na externe inspectie door een door het Productschap Diervoeder aangewezen inspectie instelling.

  • f. verpakte producten: vegen

5.3.4.2. Afleveren door derden [Vervallen per 01-01-2006]

Indien het transport wordt verzorgd in opdracht van de akkerbouwer door een extern (transport)bedrijf, dan dient dit bedrijf aantoonbaar aan de voorwaarden ingevolge de GMP standaard transport te voldoen.

  • -

    De transporteur dient over een certificaat te beschikken;

  • -

    En een kopie hiervan is in de administratie van de teler aanwezig.

5.3.5. Loonwerk [Vervallen per 01-01-2006]

De werkzaamheden die uitgevoerd worden door een loonwerker dienen uitgevoerd te worden volgens de voorwaarden gesteld in deze standaard.

  • -

    De teler is verantwoordelijk dat de loonwerker werkt volgens de voorschriften en ziet hier ook op toe;

  • -

    In de administratie opnemen welke werkzaamheden (activiteit + datum)de loonwerker uitvoert;

  • -

    De teler is verantwoordelijk dat dezelfde registraties bijgehouden worden voor de werkzaamheden die uitgevoerd worden door de loonwerker.

5.3.5.1. Calamiteiten [Vervallen per 01-01-2006]

Bij calamiteiten op het bedrijf of in de directe omgeving dienen de risico's ingeschat te worden m.b.t. de voedermiddelen.

Het bedrijf dient in ieder geval:

  • -

    bij brand, ongelukken of vondst (waarbij sprake kan zijn) van glas, olie, chemicaliën, of quarantaine organismen etc. corrigerende maatregelen te treffen;

  • -

    Voorkomende calamiteiten te registreren;

  • -

    Getroffen corrigerende maatregelen te registreren.

12. GMP - standaard opslag, bewaring en vervoedering van diervoeders op het varkenshouderij bedrijf GMP12;11-4-2003 [Vervallen per 01-01-2006]

Inhoudsopgave
1 Onderwerp & Toepassingsgebied 3
2 Normatieve Verwijzingen 3
3 Termen, Definities, Doelgroepen 4
 

3.1

Termen en Definities

4

 

3.2

Doelgroepen

4

4 Kwaliteitssysteemeisen 4
 

4.1

Normen

4

 

4.2

Identificatie en Naspeurbaarheid van Producten

4

 

4.3

Procesbeheersing

4

 

4.4

Identificatie en Naspeurbaarheid van Producten

4

 

4.5

Procesbeheersing

4

  4.5.1 Teelt 4
  4.5.2 Oogst en inschuren 5
  4.5.3 Opslag (op de boerderij) 5
  4.5.4 Afleveren 5
 

4.6

Inkoop en Ontvangst van Voedermiddelen danwel Diervoeders

5

  4.6.1 Inkoop 5
  4.6.2 Ontvangst 5
 

4.7

Opslag en Verwerking van Voedermiddelen dan wel Diervoeders

6

  4.7.1

Opslag

6
  4.7.2

Voersysteem

6
 

4.8

Keuringen en Beproevingen

6

  4.8.1 Monstername 6
 

4.9

Transport

6

  4.9.1 In eigen beheer 6
  4.9.2 Afleveren door derden 7
5 Beoordeling en Certificatie

7

1. Ontwerp en toepassingsgebied [Vervallen per 01-01-2006]

De GMP-regeling diervoedersector is opgezet voor de productie van, handel in, transport en op- en overslag van voedermiddelen, mengvoeders, voormengsels en toevoegingsmiddelen.

Voor de verschillende schakels in de diervoederkolom bestaan GMP-codes. Met de onderhavige GMP-code voor de opslag, bewaring en vervoedering van diervoeders op het varkenshouderijbedrijf (GMP12) wordt de GMP-regeling aangevuld met de borging van de laatste stap in de diervoederkolom, namelijk vanaf de opslag, bewaring op het varkenshouderijbedrijf tot aan de vervoedering (trog) c.q. mond van het dier.

Het doel van de GMP-regeling is producten en diensten voort te brengen, op een wijze die in hoge mate waarborgt dat leveranciers van deze producten en diensten voldoen aan de eisen in wet- en regelgeving, verband houdende met de veiligheid voor mens, dier en milieu (basiskwaliteit) van diervoeders én aan de additionele eisen die overeengekomen zijn met de ketenpartijen in de dierlijke productieketen in het kader van IKB-regelingen van de vee-, vlees-, eieren- en KKM-regeling in de zuivelsector of aanvullende kwaliteitsregelingen.

Het zelf door de ondernemer, via een kwaliteitsborgingsysteem, aantoonbaar maken dat basiskwaliteit wordt gewaarborgd is de basis voor de integrale ketenbeheersing (IKB) in de veehouderijsectoren. Diervoeders, geleverd door GMP-gecertificeerde ondernemers, zijn een voorwaarde in IKB programma's voor de verschillende diersectoren.

Voor de GMP-codes (GMP02 t/m GMP09) geldt de algemene GMP-code, met minimum eisen aan het kwaliteitsysteem van een bedrijf. Daarnaast geldt een aantal aanvullende eisen, waaronder de HACCP-criteria en aanvullende specifieke beheersmaatregelen die afgeleid zijn van de risicobeoordeling.

Bij deze GMP-code voor de opslag, bewaring en vervoedering van diervoeders op het varkenshouderijbedrijf is de algemene GMP- code niet van toepassing. Het bevat een aantal praktische beheersmaatregelen, die gebaseerd zijn op een op HACCP gebaseerde risicobeoordeling van de opslag, bewaring en vervoedering op het varkenshouderijbedrijf.

Bij HACCP (Hazard Analyses of Critical Control Points) worden alle stappen in het voortbrengingsproces geanalyseerd en worden de potentiële gevaren (hazards) voor productkwaliteit en -veiligheid geïdentificeerd en beschreven. Alle mogelijke risico's voor productkwaliteit en -veiligheid moeten adequaat via opgestelde procedures en instructies worden beheerst.

2. Normatieve verwijzingen [Vervallen per 01-01-2006]

Deze GMP-code is een onderdeel van de GMP-regeling diervoedersector.

Het doel is te voldoen aan de eisen omtrent basiskwaliteit. Dit behelst de normen en voorschriften zoals vastgelegd in de diervoederwetgeving, aangevuld met aanvullende normen, met de dierlijke productieketen op sectoraal niveau afgesproken.

De normen en voorschriften die in het kader van deze GMP-standaard geborgd dienen te worden, zijn vastgelegd in het kader van deze GMP-regeling diervoedersector (GMP14: Productnormen GMP die voeder sector).

3. Termen, definities, doelgroepen [Vervallen per 01-01-2006]

3.1. Termen en definities [Vervallen per 01-01-2006]

Voor de definitie van onderstaande termen wordt verwezen naar de Verordening PDV erkenningsregeling GMP diervoedersector 2003 en de EG-richtlijnen met betrekking tot diervoeders.

Er wordt tevens aangesloten bij de termen en definities van ISO 8402:1994.

Aanvullend zijn de volgende termen van toepassing:

Afnemer [Vervallen per 01-01-2006]

Diegene die producten/diensten koopt van de ondernemer.

Ondernemer [Vervallen per 01-01-2006]

Met ondernemer wordt verstaan de ondernemer waarop de GMP-code van toepassing is.

Risico [Vervallen per 01-01-2006]

De waarschijnlijkheid dat een bepaald potentieel gevaar (hazard) een negatief effect heeft.

3.2. Doelgroepen [Vervallen per 01-01-2006]

De doelgroepen van deze GMP-code zijn:

  • a) ondernemers die voeder(s)middelen in opslag en bewaring hebben en deze vervoederen aan varkens op het eigen bedrijf

4. Kwaliteitssysteemeisen [Vervallen per 01-01-2006]

4.1. Directieverantwoordelijkheid [Vervallen per 01-01-2006]

-

4.2. Kwaliteitssysteem [Vervallen per 01-01-2006]

-

4.3. Normen [Vervallen per 01-01-2006]

De wettelijke normen voor gebruik van technische hulpstoffen en voor voedermiddelen zijn van toepassing.

4.4. Identificatie en naspeurbaarheid van producten [Vervallen per 01-01-2006]

Voeders (droge en natte) dienen traceerbaar te zijn vanaf de aankoop van de grondstoffen (inclusief transport) tot en met de vervoedering.

De varkenshouder dient minimaal de volgende gegevens in de administratie vastte leggen:

  • Namen van leveranciers en dienstverleners (transport, ongediertebestrijdingsbedrijven etc);

  • Ingekochte producten (productnaam, leverdatum, silonummer);

  • Registraties van controles en inspecties;

Bovenstaande gegevens dienen minimaal 1jaar bewaard te worden op een dusdanige wijze dat deze makkelijk toegankelijk zijn.

4.5. Procesbeheersing [Vervallen per 01-01-2006]

4.5.1. Bedrijfsinrichting [Vervallen per 01-01-2006]

De bedrijfsinrichting is zodanig dat verschillende producten niet onbedoeld met elkaar in contact kunnen komen zodat kruisbesmetting en onbedoelde vermenging wordt voorkomen.

Plattegrond

Aanwezigheid van plattegrond waarop minimaal de volgende punten zijn vermeld:

  • Opslagplaatsen met genummerde silo's (dichte silo's, open-, overloopsilo's, sleufsilo's, torensilo, etc);

  • Drinkwatersysteem. Leidingwater of grondwater, i.g.v. grondwater bron vermelden.

Daarnaast mogen de producten niet onbedoeld in aanraking kunnen komen met veevoedervreemde grondstoffen zoals mest en reinigings- en desinfectiemiddelen diergeneesmiddelen, gewasbeschermingsmiddelen etc.

Opslagsilo's

  • - Opslagsilo's moeten zodanig zijn geïdentificeerd dat geen onbedoelde vermengingen kunnen plaatsvinden (zeugen-, vleesvarken-, biggen-voeder);

Vreemde bestanddelen

  • - Zorgvuldig handelen bij het vervangen of verwijderen van de lampen boven openopslag (vochtrijke mengsels, mengketel etc.):,

  • - Voorkom dat gereedschap, machineonderdelen, smeerolie etc. in de producten terecht kunnen komen;

  • - Het gebruik van een kwikthermometer boven de voertrog is niet toegestaan.

Giftige materialen

  • - Opslag reiniging- en desinfecteermiddelen in een aparte ruimte/kast bewaren, die afgesloten kan worden;

  • - Het bereiden van deze middelen niet inde ruimte waar ook de brijvoeders bereid worden.

4.5.2. Bedrijfshygiëne [Vervallen per 01-01-2006]

Het bedrijf dient een adequate bedrijfshygiëne na te leven (zie IKB voorwaarden m.b.t. reinigingsplan voor o.a. silo's, mengketel, trog, droogvoerbak ed.).

4.5.3. Vogels, huisdieren en ongedierte [Vervallen per 01-01-2006]

Het bedrijf dient maatregelen te treffen waardoor de aanwezigheid van huisdieren, vogels, ongedierte (o.a. ratten, muizen, maden en vliegen) en hun uitwerpselen zoveel mogelijk wordt voorkomen (zie IKB voorwaarden voor o.a. reinigingsplan, protocol ongediertewering en -bestrijding)

4.5.4. Onderhoud installatie [Vervallen per 01-01-2006]

Het voer- en watersysteem dienen goed te functioneren, hierop dient regelmatig controle plaats te vinden.

  • - Bij aantreffen van verontreinigingen in de voeren waterinstallatie moet worden overgegaan tot reiniging. De wijze van reiniging wordt vermeld in het reinigingsplan;

  • - Bij gebruik van vlotterbakken in de afdeling dienen deze na elke ronde gereinigd te worden. Dit is niet van toepassing indiengebruik wordt gemaakt van een centrale vlotterbak;

  • - De watervoorziening levert drinkwaterkwaliteit;

  • - Deze drinkwaterkwaliteit moet voldoen aan de norm voor varkens;

  • - Wanneer het water afkomstig is van een andere bron dan het openbare leidingnet dan wordt de drinkwaterkwaliteit minimaal1 keer per jaar aangetoond door een daartoe gecertificeerde instantie;

  • - De rapportage wordt ten minste bewaard tot de rapportage van het volgendonderzoek is ontvangen met een minimum van 1 jaar;

  • - Installaties zijn gesloten systemen, zodat verontreinigingen worden voorkomen.

4.6. Inkoop en ontvangst van voedermiddelen danwel diervoeders [Vervallen per 01-01-2006]

4.6.1. Inkoop [Vervallen per 01-01-2006]

De aangekochte producten, inclusief de producten afkomstig van eigen teelt, dienen te voldoen aan de normen zoals vastgelegd in wet- en regelgeving.

  • - Mengvoeders, voormengsels en voedermiddelen worden aangekocht van GMP+of HACCP gecertificeerdetoeleveranciers;

  • - Voedermiddelen (direct) afkomstig van eigen teelt en buurmansteelt dient te voldoen aan de voorwaarden van de GMP code "teelt van voedermiddelen".

4.6.2. Ontvangst [Vervallen per 01-01-2006]

Bij ontvangst van de producten dient gecontroleerd te worden of deze voldoen aan de overeengekomen productspecificaties.

De varkenshouder dient minimaal per product de volgende punten te borgen bij ontvangst van de producten:

Natte bijproducten/voedermiddelen

  • -

    wijze van conservering;

  • -

    houdbaarheidstermijn;

  • -

    bewaaradvies meegeleverd door de leverancier.

Geadviseerd wordt om daarnaast bij ontvangst controle op bederf (geur) en afwijkende kleur en structuur uit te voerenen evt. een pH meting uit te voeren.

Mengvoeders

  • -

    Per aangekochte partij type voer (biggenkorrel, zeugenkorrel etc);

  • -

    Per aangekochte partij houdbaarheidstermijn.

Voormengsel/premix

  • -

    Per aan gekochte partij type voormengsel (doeldier en dosering);

  • -

    Per aangekochte partij houdbaarheidstermijn.

Gemedicineerde voeders

  • -

    Per aangekochte partij type gemedicineerd voer (doeldier, dosering, wachttermijn);

  • -

    Per aangekochte partij houdbaarheidstermijn.

4.7. Opslag en verwerking van voedermiddelen dan wel diervoeders [Vervallen per 01-01-2006]

4.7.1. Opslag [Vervallen per 01-01-2006]

De producten dienen op een zodanige wijze opgeslagen te worden dat achteruitgang en kruisbesmetting van de voeders voorkomen wordt.

Algemeen

  • -

    Voer dient op een adequate wijze opgeslagen te worden en bij voorkeur in afgesloten tonnen/boxen/silo's/zakken etc.

Silo's (open-, overloop-, dichte-, toren en sleufsilo's)

  • -

    De ontvanger van het product moet de bestelling en de ontvangst zodanig georganiseerd hebben dat het juiste product in de juiste silo komt;

  • -

    Geen gebruik van open silo's (sleufsilo's afdekken).

4.7.2. Voersysteem [Vervallen per 01-01-2006]

Tijdens de bereiding en vervoedering dient ongewenste uitgroei van micro-organismen (schimmels, gisten, bacteriën) voorkomen te worden (in het brijvoersysteem en de trog).

  • -

    Door de pH laag te houden bij de bereiding van het brijvoer wordt uitgroei van bepaalde bacteriën voorkomen. Door het bereide voeder snel te vervoederen, bij voorkeur in dezelfde voerbeurt, wordt uitgroei van micro-organismen en gisting voorkomen;

  • -

    Water dient van drinkwaterkwaliteit (bestemt voor varkens) te zijn.

Om versleping van voer (is vermenging van de verschillende voeders) te voorkomen dient er geen voer in de leidingen/trog achter te blijven. Daarnaast dient uitgroei van micro-organismen voorkomen te worden in het achtergebleven voer.

Brijvaten

  • -

    voor bereiden van nieuwe voersoort reinigen.

Voertrog/bak

  • -

    Faecale bezoedeling zoveel mogelijkvoorkomen: een hulpmiddel hierbij is het plaatsen van trogafscheiders.

Lege plaatsen

  • -

    Op lege plaatsen dient het achtergebleven voer verwijderd te worden;

  • -

    Ventiel afsluiten.

4.8. Keuringen en beproeving [Vervallen per 01-01-2006]

4.8.1. Monstername [Vervallen per 01-01-2006]

De controlerende instantie kan (bij indicatie, verdenking m.b.t risico's in het kader van voedselveiligheid) een monster nemen van het betreffende voeder. Dit kan bij zowel aangekondigde, als ook bij onaangekondigde bezoeken plaatsvinden. Onderzoek zal plaatsvinden op relevante zaken m.b.t. voedselveiligheid (bijv. ongewenste stoffen zoals zware metalen, schimmel toxinen, dierlijke eiwitten, desinfectiemiddelen, diergeneesmiddelen ed.).

Monstername dient plaats te vinden volgens het monstername protocol gebaseerd op de EU richtlijn 76/371.

4.9. Transport [Vervallen per 01-01-2006]

4.9.1. In eigen beheer [Vervallen per 01-01-2006]

Indien het transport wordt uitgevoerd in eigen beheer dient reiniging van de transportmiddelen plaats te vinden volgens het reinigings- en ontsmettingsregime, zoals vermeldt in de GMP code transport. Dit betekent dat voor transport van diervoedergrondstoffen de wagen/hulpmiddelen/fusten minimaal gereinigd dient te worden volgens onderstaande eisen:

Na vervoer van:

  • a. Diervoedergrondstoffen: vegen

  • b. grond/stenen: reinigen met water (hogedruk)

  • c. kunstmest: reinigen met water

  • d. droge stapelbare pluimvee- en paardenmest: reinigen met water + desinfectie

  • e. natte mest, drijfmest: reiniging, desinfectieën externe inspectie conform de GMP-regeling transport

  • f. Verpakte producten: vegen

Inregenen en besmetting met uitwerpselen van vogels wordt voorkomen door de lading afte dekken tijdens transport.

4.9.1. Afleveren door derden [Vervallen per 01-01-2006]

Indien het transport in opdracht van de varkenshouder wordt verzorgd door een extern (transport)bedrijf, dient dit bedrijf aantoonbaar aan de vooewaarden ingevolge de GMP code transport te voldoen.

  • -

    De transporteur dient over een certificaat te beschikken;

  • -

    En een kopie hiervan is in de administratie van de varkenshouder aanwezig.

5. Beoordeling en certificatie [Vervallen per 01-01-2006]

De beoordeling op het voldoen aan deze GMP- code en de certificatie van de bedrijven vindt uitsluitend plaats door het Productschap Diervoeder geaccepteerde instellingen, die voldoen aan nader door het productschap vast te stellen voorwaarden en criteria.

13. Quality Control of Feed Materials for Animal Feed GMP13; 11-4-2003 [Vervallen per 01-01-2006]

Index
Preface 3
1 Introduction 4
2 Scope 6
3 Definitions 6
4 Basic Requirements 9
 

4.1

Basic Requirements for Producers

9

 

4.1.1

Awareness

9

 

4.1.2

Quality Control System

9

 

4.1.3

Quality Control Documentation

9

 

4.1.4

Independent verification

10

 

4.1.5

Management responsibility

10

 

4.1.6

Other documentation

10

 

4.2

Basic Requirements for Traders

11

5 Specific QC - Requirements 13
 

5.1

General

13

 

5.2

Product Specification

14

 

5.3

Production Process Specification

14

 

5.4

Hazard Identification

15

 

5.5

Risk Evaluation and Determination of Critical Control Points

16

 

5.6

Control Measures for Critical Points

17

 

5.7

Monitoring and Verification

21

 

5.8

Evaluation, Actualisation and Communication

22

6 Periodical External Verification Audit 23
7 Useful Documents 23

Preface [Vervallen per 01-01-2006]

In June 2001 the Product Board Animal Feed (The Netherlands) laid down the first version of the Standard Quality Control of Feed Materials for Animal Feed. This standard is part of the scheme GMP+ Animal Feed, especially for the quality control of feed materials supplied from abroad.

In the second half of 2001 we have had deliberations with UKASTA (United Kingdom) about the exchangeability of the Dutch QC-standard and the British FEMAS (Feed Material Assurance Scheme), both intended to assure the quality and safety of feed materials. In order to reach the exchangeability, we have added some elements in this version two of the QC - standard, especially in the explanations notes. Therefore, this version does not differ from the previous version substantially. The Product Board Animal Feed has determined this version in his meeting of 23 January 2002.

At last, we want to emphasize that, when a foreign supplier has already a quality control program put in place, this QC - standard has not to replace it, or that a separate audit has to be carried out by the certification of verification body. We would support that the additional requirements in this standard are integrated in the existing quality system already put in place. And we would also support that verification of the QC- standard and existing quality program by the certification / verification body is carried outduing the same verification audit.

Johan den Hartog

Secretary

1. Introduction [Vervallen per 01-01-2006]

During the past few years in the European Union different situations have occurred, causing a strongly increased interest in relation to animal feed and food safety. It does not merely concern BSE, but also the dioxin contamination in Brazilian citrus pulp (1998) and in the Belgian feed fats (1999).

The animal feed sector forms an important link in the food production chain. The animal feed sector is at the beginning of the animal production chain. Quality of milk, meat and eggs is all the more important for the Dutch agriculture, as about 60% is to be exported outside the Netherlands. For an undisturbed export the safety of these products must be irreproachable. If this would not be the case, this would result in a considerable glut and great financial damage regarding the export of animal products.

From the beginning of the nineties the quality policy of the Product Board Animal Feed is aimed at quality assurance of animal feed with help of a GMP-standard, which is based on the ISO 9002 Standard. The GMP quality system for animal feed is part of the integral chain control systems (IKB) in the pork- poultry- (meat and eggs), dairy cattle- and cattle sectors.

The quality assurance of animal feed that was used until the middle of 1999 proved to be insufficient and could not prevent unforeseen contamination. The former safeguarding and control activities were mainly aimed at so-called known risks in the primary route of cultivating, handling, treatment and processing of feed materials and base products which had occurred in the past, and therefore it was mainly reactive in nature.

In June 1999 the Product Board Animal Feed decided to enhance the quality guarantee regarding the Dutch animal feed sector, choosing for:

  • a pro-active approach for the control of risks in the entire production chain. With hazard analysis at chain level and HACCP (Hazard Analysis & Critical Control Points) at company level.

  • extension of the quality control to the entire chain of suppliers of feed materials.

  • an early warning system (EWS), which is intended to be a safety net, additionally to quality management systems like GMP, ISO 9002 and HACCP. The goal is to spot, communicate and eliminate a possible or potential hazard, which may occur not- withstanding all preventive measures.

In the year 2000 these elements have been entered in the Standard GMP Animal Feed. Participation in this quality scheme is not limited to Dutch companies in the animal feed sector; more and more Belgian and German companies are participating.

The above mentioned risk analysis is made up of three components:

  • Risk assessment by scientific and expert advise and information analysis

  • Risk management by issuing regulations, control measures, etc.

  • Risk communication.

It is essential, that by a systematic process, potential risks and critical points in the production chain are identified, control measures are applied beforehand and their effectiveness is verified afterwards. The quality of animal feed must be such, that the safety of the animal (animal health) and of the human being as the consumer of animal production (public health) is sufficiently guaranteed. This improved and strengthened system must have the continued trust of the consumer and other chain partners of animal production (meat, dairy and egg processing industry), as well as retail and government.

With this enhancement of the standard GMP Animal Feed the animal feed sector has chosen to integrate the HACCP-requirements (the same requirements that are also applied in the European food industry) in the GMP standard. This upgraded standard is called GMP +. This integration of HACCP into GMP emphasises that the animal feed sector (and preceding chains) is part of the food industry. Thus the communication slogan for this new quality approach is "Feed for Food".

The basis of the quality policy of the Product Board Animal Feed, is that the individual entrepreneur is himself primarily responsible for the quality and safety of his products for each part of the chain, and therefore can be made responsible. Legal product liability stresses this as well.

This standard is especially focussed at the extension of the quality control to the foreign suppliers of animal feed materials. It is a standard with minimum requirements for quality control, because not all suppliers of feed materials worldwide (already) apply an extensive and comprehensive quality management system.

2. Scope [Vervallen per 01-01-2006]

To enhance the quality assurance for the animal feed sector, in the standard GMP Animal Feed is required that the quality system must encompass the preceding production links and the trade in feed materials. This quality system, based on the HACCP-principles, must provide a safety guarantee of feed materials regarding animal feed.

In the standard GMP Animal Feed therefore is stated that a supplier abroad at least has a quality control system that is in compliance with the requirements of GMP- standard 13 (this standard), and is certified as such

This means that the foreign supplier, who wants to deliver feed materials to the GMP- certified purchaser, must set up a Quality Control System which is based on HACCP- principles.

This standard contains the minimum requirements for this Quality Control System, material.The foreign supplier of feed materials can use it.

This standard can also be used by inspection bodies to assess the suppliers' ability to meet the customer's requirements.

3. Definitions [Vervallen per 01-01-2006]

Product BoardAnimal Feed (PDV) [Vervallen per 01-01-2006]

The Product Board Animal Feed is an organisation by public law in the Netherlands. In the General Board are represented all trade associations and trade unions involved in the agricultural and industrial production of feed materials and compound feeds, trade in these feed materials and the stock farmers as end users. It includes rough fodder, dry and moist feed materials and co-products of the food processing industry. One of the tasks is to make (voluntary) quality regulations (such as the Standard GMP Animal Feed) for the animal feed chain as a part of integral quality control systems in whole the animal production sector.

GMP [Vervallen per 01-01-2006]

Good Manufacturing Practices. Series of agreements in a branch or sector in which the standard of conduct is laid down (often with respect to hygiene / food and feed safety), focussed on safeguarding of the quality and safety of animal feed.

For the animal feed sector these measures have been laid down in the Standard GMP Animal Feed.

Standard GMP Animal Feed [Vervallen per 01-01-2006]

A set of requirements, based on ISO-9000 and HACCP (Codex Alimentarius), concerning the quality system and control measures for quality control of animal feed and feed materials, and including a set of product specifications, which must be applied to by a GMP-certified company, issued by the Product Board Animal Feed.

Quality Control System [Vervallen per 01-01-2006]

A part of the management system focussed on specific process steps for fulfilling the quality and safety requirements of the feed material.

GMP certified purchaser [Vervallen per 01-01-2006]

The entrepreneur who buys the feed material from a foreign supplier, and is certified by PDV according to the standard GMP Animal Feed. This entrepreneur can be a trader, or a producer/supplier of compound feed or feed materials.

Supplier [Vervallen per 01-01-2006]

The organisation or a person abroad which provides the feed material to a GMP certified purchaser

Feed materials [Vervallen per 01-01-2006]

All materials, auxiliaries and other (by-)products, intended to be used for the production of animal feed.

Foreign (or abroad) [Vervallen per 01-01-2006]

All countries except The Netherlands

Critical Control Point (CCP) [Vervallen per 01-01-2006]

A risk which must be controlled using a specific control measure

Point of attention (POA) [Vervallen per 01-01-2006]

A risk which must be controlled using a general control measure

Control measures [Vervallen per 01-01-2006]

Measures which control an identified risk to food or feed safety to such a degree that any risk to food is prevented, eliminated or reduced to an acceptable level.

  • Specific control measure (CCP): Specific control measures are specially developed and used to control the estimated risk.

  • General control measure: General control measures are those measures (procedures or instructions) which do not specifically apply to a single process step or which are of a global nature such as the purchasing plan, maintenance plan, cleaning plan, etc.

  • Periodic measure: Periodic measures are measures which are carried out once and which are periodically reviewed/ assessed

Hazard [Vervallen per 01-01-2006]

A biological, chemical or physical contaminant in food or feed with possible adverse consequences for health.

Hazard identification [Vervallen per 01-01-2006]

Identification of possible hazards in the production process using process diagrams, product specifications of (produced) feed, literature and other information.

HACCP (hazard analysis & critical control points) [Vervallen per 01-01-2006]

A process control system relating to food and feed safety which identifies hazards and quantifies risks. The risks are controlled using control measures.

Risk [Vervallen per 01-01-2006]

The risk of a potential hazard is the result of the severity to health and the probability of occurrence.

Risk analysis (within HACCP) [Vervallen per 01-01-2006]

The hazard identification and risk assessment form together the risk analysis (see also 4.3)

Risk assessment [Vervallen per 01-01-2006]

The collection and evaluation of information about a hazard in order to be able to decide whether this forms a risk for food and feed safety.

Risk evaluation [Vervallen per 01-01-2006]

The step in the risk assesment which determines whether a hazard is a serious risk or not. It is the result of the severity to health and the probability of occurrence.

Verification [Vervallen per 01-01-2006]

The use of supplementary information to check whether the HACCP system is (still) effective and whether it is being used as intended.

4. Basic Requirements [Vervallen per 01-01-2006]

4.1. Basic requirements for producers99 [Vervallen per 01-01-2006]

4.1.1. Awareness [Vervallen per 01-01-2006]

The supplier of feed materials for animal feed must always be aware of his responsibility for the feed and food safety of their feed materials (safety for the human and animal consumer). He is a part of the chain of food production: Feed for Food.

4.1.2. Quality Control System [Vervallen per 01-01-2006]

The supplier of feed materials for animal feed must implement a quality control system, which is based on HACCP-principles. The minimum requirements for this quality control system are laid down in this Standard. This quality control system must be documented.

4.1.3. Quality Control Documentation [Vervallen per 01-01-2006]

The supplier compiles and maintains a manual which contains or refers to all the required documents (operating procedures, instructions, forms, and other documentation) necessary for operating the Quality Control System, described in this Standard. Also, in this manual at least the following documentation (derived from the HACCP principles) is included:

  • a) Product specification: The end product specification of the feed materials: see section 5.2.

  • b) Process specification: The process steps and the process conditions of the entire production process (cultivation, storage, transfer, treatment, processing, transport, etc): see divisie 5.3.

  • c) Hazard identification: The identification of the hazards that may cause a contamination of the feed materials with microbiological, chemical or physical contaminants from the environment or the process: see divisie 5.4.

  • d) Risk evaluation and determination of critical control point: see divisie 5.5.

  • e) The control measures taken by the supplier to prevent any possible product contamination, the critical points being controlled at least: see divisie 5.6.

  • f) The measurement points and checks (monitoring and verification) that are performed to determine that the control measures are being realised: see divisie 5.7.

  • g) Evaluation and communication: see divisie 5.8.

The supplier of feed materials being established abroad commits himself by contract to the GMP certified purchaser, to immediately make this document up-to-date if modifications must occur. He also guarantees to perform the above mentioned control measures and internal checks.

Explanation [Vervallen per 01-01-2006]

Documentation concerning the quality control system [Vervallen per 01-01-2006]

Documentation according to the quality control system plays an important role in maintaining a quality control system based on HACCP. Documentation ensures that the HACCP system is demonstrably present. Documents also provide information to employees about the tasksto be carried out and the agreements made within a company. There must be a clear, unambiguous structure in documents, instructions, forms and in the other documentation. For example the requirements to be laid down, the measures to be taken, etc. can be expressed in procedures, plans, instructions, other documents (like registration forms, specifications, etc).

4.1.4. Independent verification [Vervallen per 01-01-2006]

A verification audit is periodically performed by an inspection body, accepted by the Product Board Animal Feed100. See also divisie 6.

4.1.5. Management responsibility [Vervallen per 01-01-2006]

There are a number of requirements relating to animal feed safety, which fall within the responsibilities of management. These include

  • Formulation of the scope of the QC- system: The scope of the QC-system must be indicated. All product(group)s, process lines and production and storage locations for which the organisation is responsible must be involved in the system. The position of the business in the agricultural feed chain must also be indicated.

  • Tasks, responsibilities & authorities (TRA's): When setting up the QC-system it is also important to lay down the TRA's of employees, especially the tasks, responsibilities and authorities of employees with regard to food and feed safety must be included. All personnel involved in the production, storage or handling of feed materials shall have appropriate training in safe, hygienic and effective working practices. When necessary a training must take place to make sure the personnel is competent to carry out the tasks.

Records must be kept of education, experience and training.

4.1.6. Other documentation [Vervallen per 01-01-2006]

4.1.6.1. Contracts [Vervallen per 01-01-2006]

All feed materials shall be sold by contracts. These contracts shall clearly state the type, quantity, quality, price and position of goods sold. All terms shall be precise and unambiguous, preferable in accordance with recognised contractual terms.

The supplier must provide his client with the necessary information about the scope of his Quality Control System and other important information about the delivered feed

materials, so his client (the next part of the chain) can apply an adequate risk assessment himself.

4.1.6.2. Order Receipt & Processing [Vervallen per 01-01-2006]

A supplier shall be able to demonstrate appropriate methods for confirming and recording the type, quantity and quality of orders received.

In all cases, the goods provided shall be demonstrably equivalent to those contracted for supply.

4.1.6.3. Packaging and delivery documents [Vervallen per 01-01-2006]

These documents shall be clear and unambiguous. All relevant contractual and legal information must be included on delivery documents. For feed materials sold in bulk, this shall include Statutory Statements required under EU Labelling Regulations. Any information provided on delivery documents must be valid for the feed materials associated with them.

4.2. Basic requirements for traders [Vervallen per 01-01-2006]

Traders must have a quality control system which is in compliance with the requirements mentioned in chapter 4.1. If necessary, also relevant requirements form chapter 5 must be met.

Explanation: [Vervallen per 01-01-2006]

In the whole of the GMP+-chain it is necessary that all companies in that chain have the required quality assurance system in place. For foreign suppliers the minimum level of qualityassurance is laid down in this standard (the QC-standard).

When a supplier is not the first part of the GMP+ -feed chain (for example a trader) he mustmake sure he applies the relevant requirements of this standard. For instance requirementsconcerning:

  • contracts,

  • legislation (labelling, etc.,)

  • tracking and tracing,

  • documentation,

Although a trader may not actually handle the feed materials he must apply the relevant HACCP-principles to analyse his process, to identify and assess the potential hazards, and to take the necessary steps to control all possible risks. This is especially important when a traderis responsible for any part of the handling of feed materials (for instance: storage or transport offeed materials). A trader must then demonstrable apply the relevant parts of this standard inhis quality system.

A trader must especially ensure that when he is delivering feed materials to a GMP+ - recognised company, he himself only buys these feed materials from a supplier of feed materials, who also is at least QC-verified. The trader must have procedures developed en documented to ensure that a GMP+-company only is supplied with at least QC-guaranteed feed materials. In his administration theremust be a demonstrable en clear separation between non-GMP - feed materials and GMP+- feed materials.

He needs to inform his customer with relevant information about the feed matehal so this customer can apply an adequate HACP-analyses himself

A trader must keep adequate recording and documentation procedures in order to verify compliance to this standard.

5. Specific QC - requirements [Vervallen per 01-01-2006]

5.1. General [Vervallen per 01-01-2006]

The requirements mentioned in divisie 4 are most essential for setting up and putting in place an adequate quality control system, which must be documented. Therefore, in this chapter these minimum requirements are more detailed mentioned.

A supplier must have demonstrably implemented these elements in his operational management.

Explanation: [Vervallen per 01-01-2006]

The steps of a risk assessment are as follows:

  • Product definition.

  • Production Process definition

  • Hazard Identification.

  • Risk evaluation

  • Determination of critical points.

Based on the drawn-up product specification and process specification the potential hazards and risks must be identified, which may influence the quality respectively safety of the product - when used as animal feed or ad material - for the human being (consumer of animal products),animal and environment. After identification of the hazards the critical points in the productionprocess are identified and documented.

When the hazards have been identified, it must be established in which process step(s) there will be a critical control point (CCP) and/or which other control measures are necessary. These CCP's must be defined and documented.

Very helpful for the documentation of the risk assessment process is the following table, which contains each step mentioned hereafter.

Process:

no.

Process step

Hazard description

Cat.

Prob.

Sev

Risk

Motivation of the risk

Type of measures

Reference

                   

5.2. Product Specification [Vervallen per 01-01-2006]

A supplier identifies which specifications his feed materials has to meet regarding quality respectively safety, and which additional (quality) requirements his buyer wants to be guaranteed.

This must include:

  • legal demands (statutory demands in the European Community).

  • demands from sectoral agreements (chain parties, other market parties)

  • other GMP-requirements.

  • additional demands from the client (for example: non GM-demands) Additionally the following items must be entered in a product specification:

  • Name of the product

  • Description of product (chemical, micro-biological, physical, nutritional, etc.)

  • Intended use

  • Transport, storage and usage rules to maintain the product characteristics

Explanation: [Vervallen per 01-01-2006]

Information about feed materials and products is necessary for correct estimation of the hazards that could be present in the production process or which hazrds may be present in the final products (animal feed), for the animals and/or human beings. Product specifications will give a first indication of possible hazards.

It is also necessary for the supplier to be aware what the client's requirements are and what he has to comply with. For instance, if a client has certain demands about non-GM feed materials, the supplier also needs to make sure these requirements are guaranteed.

5.3. Production Process Specification [Vervallen per 01-01-2006]

The supplier describes the production process, with all process steps and process conditions, also with help of process diagrams and added explanations.

The process specification is specific for each company. Symbols may be used for describing the process. A map with the facilities of a company may be of help for systematically mapping of the processes. The process definition includes the preceding process steps (like cultivation, harvesting, storage and transport) when the supplier is not the primary producer.

Explanation: [Vervallen per 01-01-2006]

A production process specification offers insight into the actions, activities and conditions that a product undergoes in a company and the links that are ahead. Such a process specification also serves as a basis for the estimation of hazards that could possibly arise or develop.

In a production process specification is indicated, which process steps need to be followed to achieve a specified product. This also indicates which feed materials and technical auxiliaries are used, which semi manufacturers, co- and end products result during the process. Also insight is given as to how return flows are processed. Each process, production or processing step, must be shown separately in the process description.

The Product Board Animal Feed has made several general risk analysis as an example. Theserisk analysis can be obtained from the Product Board Animal Feed.

5.4. Hazard Identification [Vervallen per 01-01-2006]

The supplier identifies and evaluates all possible hazards which may occur, and classifies these hazards as chemical, physical or microbiological. This must be done for each step of the production process.

Explanation: [Vervallen per 01-01-2006]

The potential hazards must be derived from the process steps and -conditions. Normally chemical, (micro-)biological and physical hazards are distinguished. A classification is given hereafter, including descriptions and examples.

Category

Description

Examples

Chemical hazards

Unwanted chemical substances that are present in the feed materials, by natura, by pollution or by use of auxiliary materials, or that contaminate the product during production.

Residues of pesticides, heavy metals, environmental pollutants, mycotoxins, PCBs, dioxins, cleansing agents, lubricants, mineral oils, auxiliary materials from production, biological decomposition products, minerals, acid remains, etc.

(Micro-) biological hazards

Unwanted micro-organisms, toxins produced by those, and carriers of animal diseases that may enter the product or may develop. Distinction between vegetative, toxigen (forming toxins) and spore forming micro- organisms.

Salmonella, enterobacteriaceae, fungi and yeast (as indicator organisms), mammalian meal (as carrier of BSE), etc.

Physical hazards

Strange substances that may be present in the feed materials or may enter the product during storage, production and transport, and that may become a hazard to the animal

Glass, plastics, metal fragments, stones, bones, remnants of packing materials, asbestos, etc.

Hazards may occur when the product is contaminated with other substances by means of:

  • The use of auxiliaries, like pesticides, insecticides, fungicides, technological processagents which are applied or added to or may come in contact with the product

  • Specific processing steps when substances may be added to the product, like duringsteam heating, artificial drying

  • Specific conditions during cultivation, harvesting and storage when microbiological contaminants come into existence.

Especially the following (potential) hazards need attention:

  • direct artificial drying

  • steam injection

  • use of technological process agents (like gypsum, free flow agents, acid regulator) andtechnical agents (like lubricants) and

  • mycotoxins

  • transport.

In case ofdirect drying feed materials come in contact with combustion gasses. Depending of the quality of the fuel and the adjustment of the combustion installation undesirable substances can come into existence with which the feed materials can be contaminated. It concerns substances like DNMA (dinitrosomethylaminen), polyaromatic hydrocarbons, PCB's, dioxin, NOX and SOX.

In case of steam injection the quality of the steam is important because it come into contact with the feed materials. This steam quality is determined by the quality the water used in the boiler and the used technical aid agents, like corrosion preventing agents.

During the production and processing of food products and agricultural products technical (lubricants) and technological (acid regulator, binders, preservatives etc.) aid agents are often used. These aid agents can be incorporated in the co-products which are destined as feed material. Therefore, the safety of these aid agents is an important point of attention, especially whether they are of foodgrade. In cases where sanitisers are used, the supplier shall ensure that control systems provide the correct and effective dosing levels at all times. Dosing systems shall be calibrated by a competent person and calibration records maintained. Only food compatible sanitisers may be allowed to come into contact with feed materials.

Mycotoxins may come into existence during cultivation of the crops and during storage and processing of harvested products. Especially climate and storage conditions (moisture and temperature) are important. It is necessary to determine whether products are sensitive for mycotoxins or not and what the determining conditions are.

Transport is also an item which must be paid special attention to. The potential hazards can be chemical, microbiological and physical. These hazards can come from the environment or as a result of cross contamination with previous cargoes.

5.5. Risk evaluation and determination of critical control points [Vervallen per 01-01-2006]

After hazard identification it is important to evaluate whether or not a hazard is a risk or not. The risk level has to be determined in order to determine the critical control points and the kind of control measure to be carried. The supplier determines the risk level, which is the result of the probability that a hazard will occur and the severity if it occurs.

When the risks have been identified and classified, it must be established in which process step(s) there will be a critical control point (CCP) (which may be of influence to the quality respectively safety of the product - when used as animal feed (feed material) - for the human being (consumer of animal products), animal and environment) and/or which other control measures are necessary. These CCP's must be defined and documented.

Explanation: [Vervallen per 01-01-2006]

Four risk levels can be determined with the risk evaluation model. In the event of risk level 1, no measures are necessary. In the event of risk level 2, periodic measures - often activities to be performed just once - have to be carried out. Risk level 3 requires general control measures, such as hygiene programmes, maintenance and calibration, purchasing procedures, etc.These measures are often called Point of Attention (POA) or GMP measures. Most of them are already included in the GMP Standard Animal Feed. In the event of risk level 4, specific control measures are necessary for that particular situation.

The following model can be used:

Severity

Probability of occurrence (in end product; at consumption)

Great

3

4

4

Medium

2

3

4

Small

1

2

3

 

Small

Medium

Great

Part of the CCP decision tree is the risk assessment. This determines which type of control measure is necessary to eliminate a hazard and/or to reduce the risk and to control it at an acceptable level. This assessment must be carried out for every process

Control measures can vary from technical/technological solutions to organisational and/or procedural measures. There are, therefore,various possibilities for controlling risks.

5.6. Control Measures for Critical Points [Vervallen per 01-01-2006]

Based on the hazards and risk evaluation and the determination of the critical points in the production process, the supplier determines which control measures are necessary to eliminate the identified risks or to control them to an acceptable level. These control measures must be documented.

Especially when artificial drying, steam injection, technical or technological aid agents, or mycotoxins are critical points, control measures have to be made clear.

Explanation: [Vervallen per 01-01-2006]

Control measures are necessary to reduce contamination of the products by unwanted substances and products. This can be done by documented en implemented instructions, working regulations, adjustment of process conditions, training of personnel, etc.

In the standard GMP Animal Feed the necessary (generic) control measures are incorporated. If relevant these must at least be applied. When based on risk analysis specific control measures will be necessary, these must be briefly indicated in the document.

Examples of relevant (generic) control measures: [Vervallen per 01-01-2006]

Cultivation and Harvesting [Vervallen per 01-01-2006]

Cultivation and harvest instructions are necessary to guarantee the quality of the feed material.It concerns for example preventing feed materials getting wet, preventing of fungus growth, prevention of presence of contamination (for example residues of pesticides).

Mycotoxins at cultivation, harvesting and/or storage [Vervallen per 01-01-2006]

Control measures for feed materials or animal feed which are sensitive to mycotoxins, must in all stages of cultivation, harvesting and storage of the basic products and storage of the processed feed materials be aimed at making the development of mould growth asunfavourable as possible (for example choice of race of crop, way of manufacturing, way of storage). Existing control measures are:

Cultivation

  • Choose for less sensitive breeds

  • Apply full crop rotation, without maize before other cereals

  • Apply a turning up side down soil tillage

Storage

  • Avoid damage; store and transport goods dry

Control of Non-Conforming Products [Vervallen per 01-01-2006]

The supplier must also ensure that non-conforming feed material are clearly identified and segregated from both waste and conforming products in a manner that prevents inadvertent or accidental use, at all stages.

All incidences of non-conforming feed materials shall be recorded and decisions regarding actions to be taken shall only be made by nominated members of staff.

Non-conforming feed materials or product in process would normally be dealt with in one of the following ways:

  • Scrapped

  • Reworked

  • Accepted by concession (if agreed by the client)

  • Downgraded

Requirements for reprocessing non-conforming feed materials shall be documented and any affected feed material be re-evaluated on completion to ensure that the batch concerned meets specified requirements. Feed materials that do not fully meet a customer specification shall only be supplied if the customer is notified of the problem in writing and is prepared to accept them.

Site, Building and Process Equipment Requirements [Vervallen per 01-01-2006]

It may be necessary to (re)design, (re)construct and maintain buildings such that conditions within the building are suitable and do not adversely affect the quality, safety or integrity ofany feed materials either processed or kept in the building. The production, storage, transport and shipping used by the supplier shall be secure and prevent unauthorised access.

All equipment (such as sieves, screens, filters, separators, etc) used for processing, storing and transporting feed materials shall be fit for the purpose for which it is used.

Such equipment shall be subject to a program me of planned maintenance that ensures equipment is maintained in safe and hygienic working condition.

The supplier shall keep records of maintenance carried out on all critical equipment.

Intake & Loading Facilities [Vervallen per 01-01-2006]

The supplier shall ensure that all intake and loading facilities are designed and constructed in a manner that maintains the quality and safety of feed materials.

Neither discharge nor loading shall be carried out in conditions such that inclement weather or risks of contamination may affect the raw materials or feed materials being handled. Intake and loading facilities shall be designed to ensure that access by birds and other pests is kept to an absolute minimum.

In the case of flat stores, facilities shall be organised to ensure that mud, snow and other potential contaminants carried by vehicles cannot adversely affect stored raw materials or feed materials. There shall be sufficient hardstanding (e.g. concreted area) at store entrances tolimit the tracking of water and mud into the store.

Conveyors and Handling Equipment [Vervallen per 01-01-2006]

All conveying systems and handling equipment shall be maintained in a sufficiently clean and hygienic condition to avoid adversely affecting the feed materials they contact. Risk assessment procedures shall be used to identify and control any hazards that may arise. Records shall be kept detailing the time and nature of any cleaning undertaken.

Storage [Vervallen per 01-01-2006]

Feed materials and products must be stored in such a way that they can be identified easily and that confusion with other damaging products is prevented. The way in which these items have to be treated by the supplier, must be included in an instruction.

During storage, rain and stained water must be prevented from entering. Even whilst they are empty, storage and loading compartments must be covered to prevent rain-entry and pollution through bird-droppings. The thereby deployed tarpaulins must be clean and dry. Prior to loading of feeds, the exterior of the vehicle, including chassis, must be cleared of all visible residues of the preceding load.

Transport [Vervallen per 01-01-2006]

For transport of feed materials in general it applies that before loading, load compartments must be empty, clean, dry and free from any remnants and odours of previous cargoes, in order to prevent load contamination. This includes:

  • Free of possible "agribulk-unfriendly elements", such as residues of preceding cargo and/orcleansing activities.

  • Free of vermin, in the broadest sense of the word (insects and vermin, dead or alive).

In order to comply with this, it may be necessary to clean the load compartment (before loadingof the feed materials). If cleaning is necessary, this must be done in a way that is adequate inrelation to the nature of the previous cargoes. Depending on this nature of the previous cargoes, this can implicate dry cleaning (e.g. with broom) or - if necessary - cleaning with waterand possibly cleansing agents or even disinfections. After this cleansing, the load compartmentmust be inspected for cleanness.

For road transport this (cleansing and) inspection may be carried out by the transporter /road haulage company (truck driver).

In case of ocean, river and rail freight an inspection of the cleanness of the load compartments(LCI = Load Compartment Inspection) has to be carried out before loading commences. Furthermore, the loading process has to be monitored/safeguarded, in order to maintain feed and food safety. This inspection and monitoring may be carried out by:

  • a) an inspection company at the EN 45000 level, specialised in and accredited for feed/grainsor liquid agri-bulk, and internationally operating on a certified guarantee system such asISO 9000 or equivalent;

  • b) a company inspector of the chartering party or, at his request, of the supplying party, whois included in the company's own quality system as a qualified loading inspector and whose person, function and ability have been guaranteed.

Furthermore, the load compartment must be adequately shielded to protect the transported cargo against influence from other transported goods and be provided with resources to cover the cargo during transport.

In general, hygienic conditions must constantly be preserved during transport. Pollution with undesired materials and products must be prevented. This includes that mingling with other products must be prevented. A specific point of attention is that, to obliterate the spread of BSE(Mad Cow Disease), all possible and necessary preventive measures must be taken to preclude contamination of feed materials through proteins, forbidden for ruminants.

For deliveries to GMP-certified companies the road transport must be certified according toGMP07

Hygienically working [Vervallen per 01-01-2006]

During all cultivation, harvest, storage and processing steps operations must be performed hygienically to make sure that the production environment and the personnel can not contribute to contamination of feed materials. It concerns instructions for personal hygiene, industrial clothing, treatment of chemicals, general company rules concerning this, etc. The methods of hygienic working must be documented.

Cleaning [Vervallen per 01-01-2006]

A supplier must set and perform such measures, that adequate company hygiene is assured.The cleaning program must include company equipment where applicable, (company) areas and facilities, installations and (internal) transport systems. Cleaning programs must be documented, cleaning frequency and used cleaning agents must be registered, etc.

Any materials considered to be 'waste' shall be visually identified as such and promptly segregated in a manner that will eliminate the likelihood of accidental or inadvertent use. Waste material may not be collected or stored in any container that may be used for finished feed materials. In order to discourage pests and vermin, containers used to store waste materials shall be covered. They shall also be stored away from feed material storage or production areas and removed from site as frequently as practical.

All waste shall be disposed of legally.

Pest Control Program [Vervallen per 01-01-2006]

A supplier must take measures for the exclusion of vermin and to determine and document a pest control program. It concerns barring out vermin during the cultivation and harvesting process as well as fighting vermin during storage of feed materials. When executing pest control programs, acceptable pest control methods and means must be used.

Identification and traceability of feed materials [Vervallen per 01-01-2006]

It is of importance in case of problems or questions afterwards, that products in the chain can be identified and traced. Therefore it is necessary that the grower, trader and manufacturer keep a detailed administration. In this administration the relevant data for effective tracing offeed materials is included.

Contamination with specific contaminants [Vervallen per 01-01-2006]

Contamination or pollution of feed materials and products must be prevented where possible.Contamination can happen anywhere. Controls shall be in place to protect feed materials from contamination by foreign bodies.

In particular, intake points, processing equipment, conveying systems and storage facilities shall be designed and operated to minimise the possibility of ingress. Operatives, drivers and maintenance personnel shall all be trained and supervised so as to ensure that the risk of foreign materials ingress is kept to an absolute minimum.

Wherever possible, process and storage facilities shall be enclosed to avoid contact with potential contaminants as well as access for pests and vermin. Where this is not possible, appropriate controls shall be in place to ensure minimal risk to feed material integrity.

Especially adequate control measures must be taken and documented regarding the following fields:

Contamination during (artificial) drying in direct contact with combustion gases. [Vervallen per 01-01-2006]

Important is the quality of the fuel. Control measures could be taken for example in the form of forbidding unsuitable fuels and prevention of uncontrolled combustion. It is important to make clear in which way the quality of the fuels and the adjustment of the drying installation are guaranteed. Extensive control measures are

  • Specification of the fuel quality and appointments with the supplier, based on risk evaluation Use only mineral fuels (gas, coal, petroleum) which are suitable according to the specification of the supplier.

  • Specification of control measure to avoid contamination of fuels during storage and transport

  • Specification of the checks of the fuel's quality

  • Specification of the adjustment of the burner and dryer installation to avoid incomplete combustion

Technical and technological aid agents [Vervallen per 01-01-2006]

The supplier who adds technical and technological aid agents to the feed materials must apply certain control measures to prevent contamination of the feed materials

  • Specification of the quality of the technical and technological aid agents

  • Specification of de quality control of the technical and technological aid agents

Steam injection [Vervallen per 01-01-2006]

The supplier who uses steam in the production process of the feed materials must be sure that the feed materials are not contaminated due to the poor quality of the water he uses. It is important that there are specifications of:

  • the quality of the water, which is used for steam injection and the technical aid agents like corrosion preventing agents

  • the quality control of the water and the technical aid agents

5.7. Monitoring and Verification [Vervallen per 01-01-2006]

In order to be able to check whether control measures are effective, the critical points in the production process and the products themselves are periodically inspected and sampled (monitoring). This must be done by a documented schedule (plan). All results of inspections, and controls must be recorded.

If from these tests it proves that the effectiveness is not sufficient, corrective measures must be taken for the realisation of the desired result. The monitoring and verification strategy, as well corrective measures have to be documented, as well as the way in which the buyers of the results are being informed.

Explanation: [Vervallen per 01-01-2006]

The verification strategy must be based on the performed risk evaluation) and the risk parameters that are part of that. The results are an important source of information for the company and may play a role for the management of the processing. The verification strategy does not only comprise the process parameters and product parameters that are being monitored, but also the measuring frequencies and -methods. Basic assumption is that the measuring methods for the product quality are based on internationally standardised laborator/ methods and performed by qualified laboratories.

Following implementation of a quality control system it is important to plan the quality checks, sampling, analyses, registrations and inspections which must be carried out according to the quality control system. Schedules and/or plans are necessary for this. All results of inspections,and controls must be recorded.

It is necessary that the clients have insight in the measuring results, in order to be able to keep insight in the way of realisation of the risk control during the process. Apart from that it can be useful for the supplier involved to have insight in the development of the presence of critical substances on that particular chain level. The Product Board Animal Feed has a database available for unwanted substances and products, which is accessible via the internet online for whom are participating. A possibility is that participants supply data to the database under certain conditions. Participants can subscribe for this at the Product Board Animal Feed.

5.8. Evaluation, actualisation and communication [Vervallen per 01-01-2006]

The manual, which consists of the previous steps, must be actualised for modifications in the production process. If there are no modifications, actualisation would be necessary at least every two years based on advancing insight.

It is also important to perform an evaluation preceding to the actualisation. This will also give input to the improvement cycle.

The customer must be informed when a feed material does not meet the agreed specifications. The supplier must also inform his customer when the scope of the QC- system has changed.

6. Periodical External Verification Audit [Vervallen per 01-01-2006]

In the Standard GMP Animal Feed is stated that the QC-system and the contents of the manual must be verified at least once every two years, by an accepted inspection body101. Because most suppliers have started with the development and implementation of a Quality Control system recently, the verification frequency is for temporarily at least once a year.

This means at the start an initial audit, after one year a surveillance audit, etc, etc.

The inspection bodies for the verification audits accepted by the Product Board Animal Feed are published on its website, as well the procedure for acceptance of this bodies102.

The performance of a verification audit can be initiated by the supplier himself or the customer. Also other parties involved may initiate a verification audit.

All foreign feed material suppliers who are approved by the accepted inspection bodies, are published by the Product Board Animal Feed on its Internet site.

Also on the PDV-website (www.pdv.nl) a Frequent Asked Questionslist is published with information about the verification audits, for instance a guideline for the minimum length of time for an audit.

7. Useful documents [Vervallen per 01-01-2006]

  • HACCP-manual Animal Feed Sector: a useful guide to help implement the required QC-system

  • Standard GMP Animal Feed

  • Risk Assessments of about 80 feed materials

14. Productnormen GMP - regeling diervoedersector GMP14; 11-4-2003 [Vervallen per 01-01-2006]

Toelichting

De in deze bijlage opgenomen productnormen zijn ten dele gebaseerd op in de Europese Unie of nationaal (Nederland) wettelijk vastgestelde normen voor producten, ten dele aanvullend vastgesteld in het kader van de GMP-regeling diervoedersector, in overeenstemming met de schakels in de dierlijke productieketen. Indien in een land andere nationale wettelijke normen van kracht zijn, zijn deze van toepassing.

Inhoudsopgave [Vervallen per 01-01-2006]

  • A. Overzicht wettelijke en aanvullende GMP productnormen voor de diervoedersector

  • B. Negatieve lijst

  • C. Overige normen

 

Contaminant

Product

Actiegrens103

Afkeurgrens104

Bron

Aanvullende voorwaarden

Microbiologisch

M1

Antibacteriële remming

Producten van dierlijke oorsprong

-

< 15 mm

GMP

Volgens de 5-platentest MB003, afgeleid van EG-4-platentest, productbasis (RIVM- rapport nr. 206; Archiv fur Lebensmittelhygiene 31 (1981) pag. 97-140.

M2

Clostridia

- Voedermiddelen voor levering aan veehouders en;

1.000 kve/g

-

GMP

De streefwaarde is 100 kve/g

(productbasis)

 

- Vochtrijke mengsels voor levering aan veehouders

(productbasis)

 

M3

Enterobacteriaceae

Pluimveemengvoeders voor:

Procesnorm:

 

GMP

De streefwaarde is < 100 kve/g

 

- Topfok

}

   
 

- Opfok vermeerdering

} 100 kve/gram

   
 

- Vermeerdering

}

   
 

Thermisch behandelde (pluimveemeng) voeders voor:

     
 

a. Opfokhennen legeindsector

}

   
 

b. Leghennen

}

   
 

c. Vleeskalkoenen

}

   
 

d. Vleeskuikens

} 1.000 kve/g

   
 

e. Andere thermisch behandelde diervoeders dan pluimveemeng-voeders

}

   
 

f. Voederrniddelen (<13% vocht)

}

   

M4a

Salmonella

Vleeskuikenvoer: eindproducten en voedermiddelen bestemd voor:

   

GMP

 
 

-Topfok vleeskuikens

-

0+ % (benadering van 0%)

 
 

-Opfok vermeerdering vleeskuikens

-

0+ % (benadering van 0%)

 
 

-Vermeerdering vleeskuikens

-

0+ % (benadering van 0%)

 
 

-Vleeskuikens

-

0+ % (benadering van 0%)

 
 

Legpluimveevoer: eindproducten en voedermiddelen bestemd voor

   

GMP

 
 

- Topfok legpluimvee

-

0+ % (benadering van 0%)

 
 

- Opfok vermeerdering legpluimvee

-

0+ % (benadering van 0%)

 
 

- Vermeerdering legpluimvee

-

0+ % (benadering van 0%)

 
 

- Leghennen en opfokleghennen

1%

0+ % (benadering van 0%) voor S. enteritidus en S. typhimurium

 
 

Contaminant

Product

Actiegrens-105

Afkeurgrens-106

Bron

Aanvullende voorwarden

   

Kalkoenvoer: eindproducten en voedermiddelen bestemd voor:

   

GMP

 
 

- Opfok vermeerdering kalkoenen

-

0 + % (benadering van 0%)

 
 

- Vermeerdering kalkoenen

-

0 + % (benadering van 0%)

 
 

- Vleeskalkoenen

-

0 + % (benadering van 0%)

 
 

Overige diervoeders, voedermiddelen en vochtrijke mengsels bestemd voor veehouderijbedrijven (met uitzondering van pluimveevoeders).

-

Afwezig in 25 gr

GMP

 

M4b

Salmonella-conservering bepaald d.m.v. pH

- Voedermiddelen voor levering aan veehouders en;

 

Maximale pH voor waarborging:

GMP

Indien conservering bij een hogere pH kan worden bereikt, dient dit met gegevens onderbouwd te zijn.

Deze normen zijn niet van toepassing indien de producten afgeleverd worden bij een temperatuur van minimaal 60°C en de leverancier aantoonbaar over de bewaarcondities wordt geinformeerd.

Ook kan de afwezigheid van salmonella aangetoond worden in thermisch behandelde vochtrijke mengsels en voedermiddelen (<13% vocht) d.m.v. het voldoen aan de normen voor enterobacteriaceae, zie M4 e resp. f.

 

- Vochtrijke mengsels voor levering aan veehouders o.b.v.:

     
 

- Spontane melkzuur fermentatie

-

4.5

 
 

- Toevoegen organische zuren

 

4

 
 

- Toevoegen anorganische zuren

 

3,5

 

M5

Schimmels

- Voedermiddelen voor levering aar veehouders en;

-

10.000 kve/gr

GMP

 
 

- Vochtrijke mengsels voor levering aan veehouders

 
 

met een Aw-waarde > 0.75 (indien die niet bekend is een vochtgehalte : 13%)

 
 

Contaminant

Product

Actiegrens107

Afkeurgrens108

Bron

Aanvullende voorwaarden

Chemisch

C1

Aflatoxine B1

Voedermiddelen bestemd voor melkvee

-

0,005 mg/kg109

GMP

 
 

Overige voeclermiddelen, m.u.v:

-

0,05 mg/kg110

Richtlijn 2002/32/EG  
 

- grondnoot, kopra, palmnoot en palmpit, katoenzaad, babassu, maïs en daarvan afgeleide producten

-

0,02 mg/kg111

 
 

Volledige diervoeders voor runderen, schapen en geiten, met uitzondering van:

-

0,05 mg/kg112

 
 

- melkvee

-

0,005 mg/kg113

 
 

- kalveren en lammeren en geitenlammeren

-

0,01 mg/kg114

 
 

Volledige diervoeders voor varkens en pluimvee (met uitzondering van jonge dieren)

-

0,02 mg/kg115

 
 

Andere volledige diervoeders

-

0,01 mg/kg116

 
 

Aanvullende diervoeders voor runderen, schapen en geiten (met uitzondering van aanvullende diervoeders voor melkvee, kalveren, lammeren en geitenlammeren)

-

0,05 mg/kg117

 
 

Aanvullende diervoeders voor varkens en pluimvee (met uitzondering van jonge dieren)

-

0,03 mg/kg118

 
 

Andere aanvullende diervoeders (o.a. voor melkvee, kalveren, lammeren en jong(e) varkens en pluimvee)

-

0,005 mg/kg119

 

C2

Aldrin } afzonderlijk .

. } of

. } gezamenlijk

. } uitgedrukt

. } in

Dieldrin } dieldrin

Alle diervoeders, met uitzondering van:

-

0,01 mg/kg120

Richtlijn 2002/32/EG  
 

- vetten,

 

0,2 mg/kg121

 

C3

Arseen

Voedermiddelen, met uitzondering van:

-

2 mg/kg122

Richtlijn 2002/32/EG  
 

- gemalen grasmeel, luzememeel en klavermeel alsmede al dan niet gemelasseerde gedroogde suikerbietpulp

-

4 mg/kg123

 
 

- fosfaten en diervoeders verkregen door verwerking van vis

-

10 mg/kg124

 
 

Contaminant

Product

Actiegrens125

Afkeurgrens126

Bron

Aanvullende voorwarden

   

Volledige diervoeders, met uitzondering van:

-

2 mg/kg127

   
 

- volledig visvoeder

-

4 mg/kg128

   
 

Aanvullende diervoeders, met uitzondering van:

-

4 mg/kg129

 
 

- mineralenmengsels

-

12 mg/kg130

 

C4

Blauwzuur

Voedermiddelen, met uitzondering van:

-

50 mg/kg131

Richtlijn 2002/32/EG  
 

- lijnzaad

-

250 mg/kg132

 
 

- lijnzaadkoeken

-

350 mg/kg133

 
 

- maniokproducten en amandelkoeken,

-

100 mg/kg134

 
 

Volledige diervoeders, met uitzondering van:

 

50 mg/kg135

 
 

- volledige diervoeders voor kuikens

-

10 mg/kg136

 

C5

Biogene aminen of;

-

Diervoeders en;

2.000 mg/kg eiwit

-

GMP

De streefwaarde is 1.000 mg/kg eiwit

De streefwaarde is 2,000 mg/kg eiwit

 

-

Voedermiddelen bestemd voor verwerking in diervoeders met uitzondering van;

   
 

- Visproducten

4.000 mg/kg eiwit

-

 
 

- TVN (totaal vrij stikstof) of;

- Vrij NH3 (ammoniak) of;

- andere methode

-} Diervoeders en voedermiddelen

}bestemd voor verwerking in

}diervoeders;

}Eigen norm

}gerelateerd aan

}gehalte van

}biogene amine in

}dit product

-

GMP

Relatie met biogene amine dient onderbouwd te zijn

C6

Cadmium

Voedermiddelen van plantaardige oorsprong,

-

1 mg/kg137

Richtlijn 2002/32/EG  
 

Voedermiddelen van dierlijke oorsprong, met uitzondering van:

-

2 mg/kg138

 
 

- huisdiervoeders

-

-

 
 

Fosfaten,

-

10 mg/kg139 +140

 
 

Volledige diervoeders voor runderen, schapen en geiten, met uitzondering van:

-

1 mg/kg141

 
 

- volledige diervoeders voor kalveren, lammeren en geitenlammeren

-

-

 
 

Andere volledige diervoeders, met uitzondering van:

-

0,5 mg/kg142

 
 

- huisdiervoeders

 

 
 

Mineralenmengsels

-

5,0 mg/kg143 + 144

 
 

Contaminant

Product

Actiegrens145

Afkeurgrens146

Bron

Aanvullendo voorwaarden

   

Andere aanvullende diervoeders voor runderen, schapen en geiten

-

0,5 mg/kg147

 

Indien de norm wordt overschreden dient een attendering of verwerkingsadvies aantoonbaar met de afnemer te worden gecommuniceerd.

C7

Chloor

- Voedermiddelen voor levering aan veehouders en;

10 g/kg

-

GMP

 
 

- Vochtrijke mengsels voor levering aan veehouders

(droge stof)

   

C8

Chloorcamfee n (toxafeen)

Alle diervoeders

-

0,l mg/kg 148

Richtlijn 2002/32/EG  

C9

Chloordaan (som van cis-en transisomeren en van oxychloordaan uitgedrukt in Chloordaan)

Alle diervoeders, met uitzondering van:

-

0,02 mg/kg149

Richtlijn 2002/32/EG  
 

- vetten

-

0.05 mg/kg150

 

C10

Crotalaria spp.

Alle diervoeders

-

100 mg/kg151

Richtlijn 2002/32/EG  

C11

DDT (som van DDT-, TDE- en DDE- isomeren, uitgedrukt in DDT)

Alle diervoeders. met uitzondering van:

-

0,05 mg/kg152

Richtlijn 2002/32/EG  
 

- vetten

-

0,5 mg/kg153

 

C12

Dierlijke eiwitten

Diervoeders voor landbouwhuisdiere n

-

0

- Tijdelijke regeling verbod dierljke eiwitten in alle diervoeders landbouwhuisdieren (LNV)

- Regeling verbod diermelen in diervoeders (LNV)

 
 

Contaminant

Product

Actiegrens154

Afkeurgrens155

Bron

Aanvullende voorwaarden

C13

Dioxine156

Alle Voedermiddelen van plantaardige oorsprong, inclusief plantaardige oliën en neveneroducten en:

-

0,75 ng WHO-PCCD/F- TEQ/kg157 + 158

Richtlijn 2003/57/EG tot wijziging van 2002/32/EG

 
 

Mengvoeders met uitzondering van voeders voor pelsdieren en gezelschapsdieren en van visvoer;

 

0.75 ng WHO-PCCD/F- TEQ/kg159 + 160

 
 

Mineralen, zoals bedoeld in de bijlage bij Richtlijn 96/25/EG betreffende het verkeer en het gebruik van voedermiddelen

 

1,0 ng WHO-PCCD/F- TEQ/kg161 + 162

 
 

Kaoliniothoudende klel calciumsulfaatdlhydraat, vermiculet

natrolietfonoliet synthetische calciumaluminaten en clinoptiloliet van sedimentaire oorsprong behorende tot de groep bindmiddelen, verdunningsmiddelen en stollingsmiddelen die zijn toegelaten krachtens artikel 4 van richtlijn 70/524/EEG

 

0,75 ng WHO - PCCD/F-TEQ/kg163 + 164

  deze norm is van kracht per 1/3/04
 

Visvoer en voeders voor gezelschapsdieren

-

2,25 ng WHO-PCCD/F- TEQ/kg165 + 166

   
 

Vis, andere zeedieren en de (neven)producten daarvan met uitzondering van visolie en vise withydrolysaten die meer dan 20%vet bevatten167

 

1.25 ng WHO- PCCD/F-TEQ/kg168 + 169

   
 

Dierlijk vet, inclusief melkvet en eivet met uitzondering van visolie

-

2,0 ng WHO-PCCD/F- TEQ/kg170 + 171

   
 

Visolie

-

6 ng WHO-PCCD/F- TEQ/kg172 + 173

 
 

Andere van landdieren afkomstige producten, inclusief melk. melkproducten, eieren en producten afkomstig van eieren

-

0,75 ng WHO-PCCD/F- TEQ/kg174 + 175

 
 

Vise withydrolysaten die meer dan 20% vet bevatten

-

2,25 ng WHO-PCCD/F- TEQ/kg176 + 177

  deze norm is van kracht per 1/3/04
 

Contaminant

Product

Actiegrens178

Afkeurgrens179

Bron

Aanvullende voorwaarden

   

De volgende bindmiddelen:

E 470 Natrium-, kalium- en calciumstearaten180

E 551a Kiezelzuur, neergeslagen en gedroogd181

E 551b Colloidaal silicium182

E 551c Kieselgoer (diatomeenaarde, gezuiverd)183

E 552 Calciumsilicaat, synthetisch184

E 554 Natrium- en aluminiumsilicaat, synthetisch185

E 558 Bentoniet-montmorrilloniet186

E 559 Asbestvrije kaoliniethoudende klei187

E 561 Vermiculiet188

E 565 Lignosulfonaten189

E 566 Natroliet-fonoliet190

E 598 Calciumaluminaat, synthetisch191

E 599 Perliet192

E 516 Calciumsutfaatdihydraat193

3 Clinoptiloliet van vulkanische oorsprong194

4 Clinoptiloliet van sedimentaire oorsprong195

 

500 pg WHO-PCCD/F- TEQ/kg

Verordening EG nr. 2439/1999

 

C14

Docosahexaceenzuur (C22:6)

- Voedermiddelen voor levering aan veehouders en;

0,5%op vetbasis

-

GMP

Indien de norm wordt overschreden dient een attendering of verwerkingsadvies aantoonbaar met de afnemer te worden gecommuniceerd.

 

- Vochtrijke mengsels voor levering aan veehouders

Indien vetgehalte > 10% van de drooe stof

 

C15

DON

(Deoxynivalenol)

Graanproducten bestemd voor verwerking in:

       
 

- Varkensvoeders

-

5 mg/kg

 
 

- Rundvee- en pluimveevoeders

-

10 mg/kg

 
 

- Voeders voor kalveren tot 4 mnd en melkveevoeders

 

5 mg/kg

 
 

- Legkippenvoeders

-

5 mg/kg

 
   

Volledig mengvoeder bestemd voor:

-

   
         
 

- Varkens

-

1 mg/kg

 
 

- Rundvee en pluimvee

-

5 mg/kg

 
 

- Kalveren tot 4 mnd en melkvee

-

2 mg/kg

 
 

Contaminant

Product

Actiegrens196

Afkeurgrens197

Bron

Aanvullende voorwaarden

   

- Legkippenvoeders

-

3 mg/kg

   
 

Diervoeder op volledig rantsoen basisvoor

   

GMP

(Nog niet van kracht) 198
 

-Varkens

0,8 mg/ kg

1 mg/kg

 
 

- Rundvee

4 mg/kg

5 mg/kg

 
 

- Kalveren tot 4 mno

1,6 mg/kg

2 mg/kg

 
 

- Melkvee

2,4 mg/kg

3 mg/kg

 
 

- Pluimvee

3,2 mg/kg

4 mg/kg

 

C16

Endosulfan (som van alfa- en bèta-isomeren en van endosul-fansulfaat, uitgedrukt in endosulfan)

Alle diervoeders met uitzondering van:

 

0,1 mg/kg199

Richtlijn 2002/32/EG  
 

- maïs

-

0,2 mg/kg200

 
 

- oliehoudende zaden,

-

0,5 mg/kg201

 
 

- volledig visvoeder

-

0,005 mg/kg202

 

C17

Endrin (som van endrin en deltaketo-endrin, uitgedrukt in endrin)

Alle diervoeders, met uitzondering van:

-

0,01 mg/kg203

Richtlijn 2002/32/EG  
 

- vetten

-

0,05 mg/kg204

 

C18

Erucazuur (C22:1)

- Voedermiddelen voor levering aan veehouders en;

- Vochtrijke mengsels voor levering aan veehouders

Indien vetgehalte >10% van de droge stof

5% op vetbasis

 

GMP

Indien de norm wordt overschreden dient een attendering of verwerkingsadvies aantoonbaar met de afnemer te worden gecommuniceerd.

 

Contaminant

Product

Actiegrens205

Afkeurgrens206

Bron

Aanvullende voorwaarden

C19

Fluor

Voedermiddelen, met uitzondering van:

-

150 mg/kg207

Richtlijn 2002/32/EG  
 

- diervoeders, verkregen door verwerking van dieren

 

500 mg/kg208

 
 

- fosfaten

-

2 000 mg/kg209

 
 

Volledige diervoeders, met uitzondering van:

-

150 mg/kg210

 
 

- volledige diervoeders voor runderen, schapen, geiten:

     
 

- zogend

 

30 mg/kg211

 
 

- overige

 

50 mg/kg212

 
 

- volledige diervoeders voor varkens

 

100 mg/kg213

 
 

- volledige diervoeders voor pluimvee

 

350 mg/kg214

 
 

- volledige diervoeders voor kuikens

 

250 mg/kg215

 
 

Mineralenmengsels voor runderen, schapen en geiten

 

2000 rng/kg216+ 217

 
 

Andere aanvullende diervoeders

 

125 mg/kg218219

 

C20

Heptachloor (som van heptachloor en heptachloorepoxyde, uitgedrukt in heptachloor)

Alle diervoeders, met uitzondering

van:

-

0,01 mg/kg220

Richtlijn 2002/32/EG  
 

- vetten

-

0,2 mg/kg221

 

C21

Hexachloorbenzeen (HC B )

Alle diervoeders, met uitzondering van:

-

0,01 mg/kg222

Richtlijn 2002/32/EG  
 

- vetten

-

0,2 mg/kg223

 

C22

Hexachloorcyclohexaan HCH):

      Richtlijn 2002/32/EG  
 

- Alfa-isomeer

Alle diervoeders, met uitzondering van:

 

0,02 mg/kg224

 
 

-vetten

 

0,2 mg/kg225

 
 

- Beta-isomeer

Mengvoeders, met uitzondering van:

-

0,01 mg/kg226

 
 

- voeders voor melkvee

-

0,005 mg/kg227

 
 

Voedermiddelen, met uitzondering van:

-

0,01 rng/kg228

 
 

- vetten

-

0,1 mg/kg229

 
 

- Gamma-isomeer (lindaan)

Alle diervoeders, met uitzondering van:

-

0,2 mg/kg230

 
 

- vetten

-

2,0 mg/kg231

 

C23

Kalium

- Voedermiddelen voor levering aan veehouders en:

- Vochtrijke mengsels voor levering aan veehouders

60 g/kg (droge stof)

 

GMP

Indien de norm wordt overschreden dient een attendering of verwerkingsadvies aantoonbaar met de afnemer te worden gecommuniceerd.

 

Contaminant

Product

Actiegrens232

Afkeurgrens233

Bron

Aanvullende voorwaarden

C24

Koolwaterstoffen (C10- C40)

Dierlijk vet met uitzondering van:

-

400 mg/kg

GMP

 
 

- Ruwe visolie

-

3000 mg/kg

 
 

Plantaardige olie (met uitzondering van Zonnebloemolie)

-

400 mg/kg

   
 

Zonnebloemolie en zonnebloemvetzuren

-

1000 mg/kg

 
 

Plantaardige vetzuren incl. mengsels van vetzuren {met uitzondering van zonnebloemvetzuren)

 

3000 mg/kg

 

C25

Koper(E4)

Biggenvoer

-

160 mg/kg toegevoegd

GMP

Mengvoeders die niet voldoen aan de norm mogen niet in Nederland worden geleverd

 

Startvoer varkens

-

130 mg/kg toegevoegd

 
 

Vleesvarkensvoer

-

15 mg/kg toegevoegd

 
 

Scharrel vleesvarkensvoer

-

25 mg/kg totaal

GMP

Alleen voor scharrelvleesvarkens

 

Zeugenvoer

-

20 mg/kg toegevoegd

GMP

Mengvoeders die niet voldoen aan de norm mogen niet in Nederland worden geleverd

 

Vleeskuikenvoer

-

15 mg/kg toegevoegd

   
 

Leghennenvoer

-

15 mg/kg toegevoegd

 
 

Leg/vleeskuikenouderdieren

-

20 mg/kg toegevoegd

 
 

Opfokvoeders pluimvee

-

15 mg/kg toegevoegd

 
 

Vleeskalkoenen

-

15 mg/kg toegevoegd

 
 

Fokkalkoenen

-

20 mg/kg toegevoegd

 
 

Mestvarkens234

    Richtlijn 70/524/EG  
 

- Biggen tot en met 16 weken235

 

175 mg/kg totaal

 
 

- van 17 weken tot het slacnten236

 

35 mg/kg totaal

 
 

Fokvarkens237

 

35 mg/kg totaal

 
 

Kalveren:238

     
 

- m. u. v kunstmelkvoeder239

 

50 mg/kg totaal

 
 

- alleen kunstmelkvoeder240

 

30 mg/kg totaal

 
 

- Schapen241

 

15 mg/kg totaal

 
 

- Andere dieresoorten242

 

35 mg/kg totaal

 
 

Varkens:243

   

Richtlijn 1334/2003/EG wijziging op 70/524

deze norm is var kracht per 26/1/04

 

- Biggen tot 12 weken244

 

170 mg/Kg of mg/dag totaal

 
 

- Andere varkens245

 

25 mg/kg of mg/kg totaal,

 
 

Contaminant

Product

Actiegrens246

Afkeurgrens247

Bron

Aanvullende voorwaarden

   

Runderen

       
 

1 Runderen voordat ze beginnen met herkauwen

     
 

- Kunstmelk248

 

15 mg/kg of mg/dag totaal

 
 

- Andere volledige diervoeders249

 

15 mg/kg of mg/dag totaal

 
 

2 Andere runderen250

 

35 mg/kg of mg/dag totaal

 
 

Schapen251

 

15 mg/kg of mg/dag totaal

 
 

-Vissen252

 

25 mg/kg of mg/dag totaal

 
 

- Schaaldieren253

 

50 mg/kg of mg/dag totaal

 
 

-Andere diersoorten254

 

25 mg/kg of mg/dag totaal

 

C26

Kwik

Voedermiddelen, met uitzondering van:

-

0,1 mg/kg255

Richtlijn 2002/32/EG  
 

- diervoeders, verkregen door verwerking van vis of andere zeedieren

-

0,5 mg/kg256

 
 

Volledige diervoeders. met uitzondering van:

-

0,1 mg/kg257

 
 

- volledige diervoeders voor honden en katten

-

0,4 mg/kg258

 
 

Aanvullende diervoeders, met uitzondering van:

-

0,2 mg/kg259

 
 

- aanvullende diervoeders voor honden en katten

-

-

 

C27

Lood

Voedermiddelen, met uitzondering van:

-

10 mg/kg260

Richtlijn 2002/32/EG  
 

- groenvoeder

-

40 mg/kg261

 
 

- fosfaten

-

30 mg/kg262

 
 

- gist

-

5 mg/kg263

 
 

Volledige diervoeders

-

5 mg/kg264

 
 

Aanvullende diervoeders, met uitzondering van:

-

10 mg/kg265

 
 

- mineralenmengsels

-

30 mg/kg266

 
 

Contaminant

Product

Actiegrens267

Afkeurgrens268

Bron

Aanvullende voorwaarden

   

E 6 Zinkoxyde

-

600 mg/kg

Verordening EG nr. 92/64

 

C28

Moederkoren (Claviceps purpurea)

Alle diervoeders die ongemalen graan bevatten

-

1000 mg/kg269

Richtlijn 2002/32/EG  

C29

Natrium

- Voedermiddelen voor levering aan veehouders en;

8 g/kg

(droge stop

-

GMP

Indien de norm wordt overschreden dient een attendering of verwerkings- advies aantoonbaar met de afnemer te worden gecommuniceerd.

 

- Vochtrijke mengsels voor levering aan veehouders

 

C30

Nikkel

Voedervetten

20 mg/kg (op vetbasis)

50 mg/kg (op vetbasis)

GMP

 

C31

Nitriet

Vismeel

-

60 mg/kg270 (uitgedrukt in natriumnitriet)

Richtlijn 2002/32/EG  
 

Volledige diervoeders, met uitzondering van:

-

15 mg/kg271 (uitgedrukt in natriumnitriet)

 
 

- voeders voor huisdieren, uitgezonderd vogels en aquariumvissen

-

-

 

C32

Onkruidzaden en niet gemalen of verpulverde vruchten die alkoloïden, glucosiden of andere giftige stoffen bevatten afzonderlijk of tezamen. waaronder:

Alle diervoeders

-

3000 mg/kg272

Richtlijn 2002/32/EG  
 

a) Lolium temulentum L.

   

1 000 mg/kg273

 
 

b) Lolium remotum Schrank

   

1 000 mg/kg274

 
 

c) Datura stramonium L.

   

1 000 mg/kg275

 

C33

Onoplosbare onzuiverheden

Gesmolten vetten afkomstig van herkauwers

-

0,15%

Richtlijn 99/534/EG  

C34

Orchratoxine A

Diervoeder op volledig rantsoen basis voor

   

GMP

(Nog niet van kracht) 276
 

- zeugern en vleesvarkens en biggen

0,04 mg/kg

0,05 mg/kg

 
 

- pluimvee

0,16mg/kg

0,2 mg/kg

 

C35

Polycyclische Aromatische Koolwaterstoffen (Pak's)

Voedervetten

15 μg/kg BaPEQ (op vetbasis)

50 μg/kg BaPEQ (op vetbasis)

GMP

BaPEQ = Benzo(a)pyreen equivalent

 

Contaminant

Product

Actiegrens277

Afkeurgrens278

Bron

Aanvullende voorwaarden

C36

Polychloorbifenyle n (Pcb's)

Frituurvetten -en olien

-

200 microg/kg

Regeling vetten in diervoeders, LNV 21 januari 2001

 
 

-

250 μg/kg (op vetbasis)

GMP

 
 

Totaal van de volgende PCB's (IUPAC): 28, 52 101,

Voedermiddelen van dierlijke oorsprong (indien vetgehalte > 2% vet) met uitzondering van

 
 

Voedermiddelen van dierlijke oorsprong (indien vetgehalte < 2% vet)

-

50 μg/kg (op productbasis)

 
 

Mengvoeder met uitzondering van visvoer

-

200 μg/kg (op vetbasis)

 

C37

Polymeren triglyceriden

- Voedermiddelen voor levering aan veehouders en;

- Vochtrijke mengsels voor levering aan veehouders Indien vetgehalte >10% van de droge stof

3% op vetbasis

-

GMP

Indien de norm wordt overschreden dient een attendering of verwerkings- advies aantoonbaar met de afnemer te worden gecommuniceerd.

C38

Ricinus- Ricinus communis L.

Alle diervoeders

-

10 mg/kg279 (uitgedrukt in ricinusdoppen)

Richtlijn 2002/32/EG  

C39

Sulfaat

- Voedermiddelen voor levering aan veehouders en;

- Vochtrijke mengsels voor levering aan veehouders die met zwavelzuur worden geconser veerd en niet voor producten die van nature rijk zijn aan zwavel

8 g/kg (droge stof)

 

GMP

Indien de norm wordt overschreden dient een attendering of verwerkings- advies aantoonbaar met de afnemer te worden gecommuniceerd.

C40

Theobromine

Volledige diervoeders, met uitzondering van:

-

300 mg/kg280

Richtlijn 2002/32/EG  
 

- volledige diervoeders voor volwassen runderen

 

700 mg/kg281

 

C41

Vinylthiooxazolidon

(Vinyloxazolidine thion)

Volledige diervoeders voor pluimvee, met uitzondering van:

-

1 000 mg/kg282

Richtlijn 2002/32/EG  
 

- volledige diervoeders voor legpluimvee

-

500 mg/kg283

 
 

Contaminant

Product

Actiegrens284

Afkeurgrens285

Bron

Aanvullende voorwaarden

C42

Vluchtige mosterdolie

Voedermiddelen, met uitzondering van:

-

100 mg/kg286

Richtlijn 2002/32/EG  
 

- koolzaadkoeken

-

4 000 mg/kg287 (berekend als allylisothiocyanaat)

 
 

Volledige diervoeders, met uitzondering van:

-

150 mg/kg288 (berekend als allylisothiocyanaat)

 
 

- volledige diervoeders voor runderen, schapen en geiten (met uitzondering van jonge dieren)

-

1 000 mg/kg289 (berekend als allylisothiocyanaat)

 
 

- volledige diervoeders voor varkens (met uitzondering van biggen) en pluimvee

-

500 mg/kg290 (berekend als allylisothiocyanaat)

 

C43

Vrij gossypol

Voedermiddelen, met uitzondering van: